CX046741

Overview
NameCX046741
Unique NameCX046741
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length861
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3803 contig Csv1_Contig3803:1..862. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX046741 vs. ExPASy Swiss-Prot
Match: Y1821_SYNY3 (Putative zinc metalloprotease slr1821 OS=Synechocystis sp. (strain PCC 6803) GN=slr1821 PE=3 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.231e-25
Identity = 71/220 (32.27%), Postives = 112/220 (50.91%), Query Frame = -1
Query:  193 GLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFXXXXXXXXXXXXXXXXXXLDGGSLALILIEAARGGRKLPLEVEQQIXXXXXXXXXXXXXXXXVRDTLNLDIIKDML 852
            G+ PGD++LS+ GN  P   P+  ++ ++ +++SP   + ++V RGE+   + +TP  + +G GKIGV L PNV+  +    N LEA  ++A+ F  +         Q   NF+  AS+V+GPV I+  GA +ARS+   L+QF                  LDGG L  +LIE    G+ LP + +  +                VRDTLNL  +++ L
Sbjct:  144 GMEPGDIVLSLQGNTLPGF-PDATTQFIDIVRRSPSVPITVEVQRGEETKTLTITPTPDAEGKGKIGVALLPNVETKRA--SNPLEALTYSAEAFERIVKLTTQGFWQLISNFADNASQVAGPVKIVEYGANIARSDASNLFQFGALISINLAVINILPLPALDGGQLVFLLIEGLL-GKPLPEKFQMGVMQTGLVLLLSLGVFLIVRDTLNLTFVQEFL 359          
BLAST of CX046741 vs. ExPASy Swiss-Prot
Match: Y3971_ANASP (Putative zinc metalloprotease all3971 OS=Anabaena sp. (strain PCC 7120) GN=all3971 PE=3 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 6.076e-23
Identity = 68/190 (35.79%), Postives = 102/190 (53.68%), Query Frame = -1
Query:  283 GLFPGDVILSVNGNEFPKTGPNVVSELVNAIKKSPKRNVLLKVARGEQQFEIGVTPDENYDGTGKIGVQLSPNVKISKVLPKNLLEAFRFTAKEFWGLSCNVLDSLKQTFFNFSQTASKVSGPVAIIAVGAEVARSNIDGLYQFXXXXXXXXXXXXXXXXXXLDGGSLALILIEAARGGRKLPLEVEQQI 852
            GL PGDVILS N  EF  T    +  L + IK SP +++ L VARG+++  + V P+    G G IG+ L+PN K+ +  P +L +AF   A EF  +         Q   NF +TAS+V+GP+ I+ +GA +A+++   L+ F                  LDGG LA +LIE  R G+ LP  +++ +
Sbjct:  144 GLKPGDVILSANQKEFG-TSLQEIEALRDIIKNSPGKSIQLTVARGDERLSVNVIPEAKPAG-GSIGIGLAPNGKVER-RPVSLSKAFSVGASEFQRIVVMTFKGFGQLVTNFGETASQVAGPIKIVEIGANIAQNDTGSLFFFAALISINLAVINILPLPALDGGQLAFLLIEGLR-GKPLPNRIQEGV 329          
The following BLAST results are available for this feature:
BLAST of CX046741 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
Y1821_SYNY32.231e-2532.27Putative zinc metalloprotease slr1821 OS=Synechocy... [more]
Y3971_ANASP6.076e-2335.79Putative zinc metalloprotease all3971 OS=Anabaena ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_9H10_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-9H10-P19-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX046741 ID=CX046741|Name=CX046741|organism=Citrus sinensis|type=EST|length=861bp
TTTTAGCATCAAGTACCTATCAGATATCACCTTGGCAGAAGCAACCAATC
ATATCAATAGCGGATAACCAACTTGGTCCATCCCCTTATGATACATCATC
ACAGGTTTCTAAACTTGATACAACACGAGCTTCAAAGGAAATTTATCTCC
AACACAAACTGTCAATGATCTCCAAAGACTTTGAAGTAATCATAACATAT
CTTTGATAATATCAAGGTTAAGGGTATCACGGACAATAAGGAATAACCCA
AGGAGTAAAACCAACATAATCCCTGATGACATGATTTGTTGTTCTACCTC
TAGCGGGAGTTTCCTCCCACCTCTAGCAGCCTCTATAAGAATCAAGGCCA
ATGAACCCCCATCCAGAGCAGGTAATGGGAGAAGGTTTATCACTGCAAGG
TTAATATTGAGCACAGCTGCAAACTGGTAAAGCCCATCAATATTTGACCT
AGCAACTTCTGCACCAACAGCAATAATGGCAACAGGACCGGAAACCTTGC
TAGCCGTTTGAGAGAAGTTAAAAAATGTCTGTTTCAAACTATCCAGAACA
TTACATGAGAGGCCCCAAAATTCTTTTGCAGTAAATCTAAAAGCCTCCAA
CAGGTTCTTTGGAAGAACCTTTGAAATCTTCACATTTGGTGATAACTGGA
CTCCAATTTTACCAGTTCCATCATAATTTTCATCTGGGGTGACCCCAATT
TCAAATTGCTGCTCACCCCTTGCAACTTTAAGCAACACATTTCTTTTAGG
GCTTTTCTTGATCGCGTTAACAAGCTCAGAGACCACATTTGGACCAGTTT
TTGGGAATTCATTACCGTTAACTGAGAGGATTACATCACCAGGAAACAAT
CCATCTCGAGA
back to top