CX046735

Overview
NameCX046735
Unique NameCX046735
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length856
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3410 contig Csv1_Contig3410:60..915. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA1_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana GN=At3g12390 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 6.578e-54
Identity = 115/136 (84.56%), Postives = 121/136 (88.97%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESS--AMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AMLKLGMKPI GVSRVTVKKSKNILFVISKPDVFKSP SDTY++FGEAKIEDLSSQ+Q+QAAEQFK   P+  NV SK ESS  A+VQDDEEVDE GVEPKDIELVMTQAGV R  AVKALKAADGDIVSAIMELT
Sbjct:   69 AMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPASDTYVIFGEAKIEDLSSQIQSQAAEQFKA--PDLSNVISKGESSSAAVVQDDEEVDEEGVEPKDIELVMTQAGVSRPNAVKALKAADGDIVSAIMELT 202          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA_PINTA (Nascent polypeptide-associated complex subunit alpha-like protein OS=Pinus taeda PE=2 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.122e-53
Identity = 112/135 (82.96%), Postives = 120/135 (88.89%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQDDE-EVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AMLKLGMKP+ GVSRVT+KKSKNILFVIS PDVFKSPTSDTYI FGEAKIEDLSSQLQTQAAEQFK   PN  +V  KPESS   Q+DE EVD+TGVEPKDIELVMTQAGV R++AVKALKAADGDIVSAIM+LT
Sbjct:   72 AMLKLGMKPVSGVSRVTIKKSKNILFVISNPDVFKSPTSDTYIAFGEAKIEDLSSQLQTQAAEQFKA--PNLSHVTMKPESSTAAQEDEDEVDDTGVEPKDIELVMTQAGVSRTKAVKALKAADGDIVSAIMDLT 204          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA3_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana GN=At5g13850 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 6.807e-51
Identity = 113/141 (80.14%), Postives = 120/141 (85.11%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESS-----AMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AMLKLGMKPI GVSRVTVKKSKNILFVISKPDVFKSP SDTY++FGEAKIEDLSSQLQ+QAAEQFK   PN  NV S+ E+S     A VQ  DDEEVDE GVEPKDIELVMTQAGV + RAVKALK A+GDIVSAIMELT
Sbjct:   65 AMLKLGMKPITGVSRVTVKKSKNILFVISKPDVFKSPASDTYVIFGEAKIEDLSSQLQSQAAEQFKA--PNLSNVISQGETSSAATAAAVQDDDDEEVDEEGVEPKDIELVMTQAGVSKPRAVKALKLANGDIVSAIMELT 203          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA2_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana GN=At3g49470 PE=2 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 2.266e-46
Identity = 96/140 (68.57%), Postives = 118/140 (84.29%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSA------MVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AMLKLGMKP+ GVSRVT+K++KN+LF ISKPDVFKSP S+TY++FGEAKIEDLSSQLQTQAA+QF++  P  G  + + E+S       + +D+EE+DETGVE +DI+LVMTQAGV RS+AVKALK+ DGDIVSAIMELT
Sbjct:   79 AMLKLGMKPVTGVSRVTIKRTKNVLFFISKPDVFKSPHSETYVIFGEAKIEDLSSQLQTQAAQQFRM--PEIGATSQRAEASTATVEAQVEEDEEEIDETGVEARDIDLVMTQAGVSRSKAVKALKSHDGDIVSAIMELT 216          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA4_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana GN=At4g10480 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 1.243e-44
Identity = 96/140 (68.57%), Postives = 116/140 (82.86%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPP-----PNT-GNVASKPESSAMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AMLKLGMKP+  VSRVT+K+SKN+LFVISKPDVFKSP S+TY++FGEAKI+D+SSQLQ QAA++FK+P      PNT G+ A+        +DDE+VDETGVE KDI+LVMTQAGV R +AVKALK ++GDIVSAIMELT
Sbjct:   74 AMLKLGMKPVTDVSRVTIKRSKNVLFVISKPDVFKSPNSETYVIFGEAKIDDMSSQLQAQAAQRFKMPDVASMIPNTDGSEAATVAQEE--EDDEDVDETGVEAKDIDLVMTQAGVSRPKAVKALKESNGDIVSAIMELT 211          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA5_ARATH (Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana GN=At1g33040 PE=2 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 2.345e-43
Identity = 89/139 (64.03%), Postives = 117/139 (84.17%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPP-----PNTGNVASKPESSAMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            A+LKLGMKP+  VSRVT+K++KN+LFVISKPDV+KSP ++TY++FGEAK++DLSSQLQTQAA++FK+P      PN G+ A+     A  +D+++VD+TGVE +DI+LVMTQAGV +++AV ALKA DGDIVSAIMELT
Sbjct:   71 AVLKLGMKPVSDVSRVTIKRAKNVLFVISKPDVYKSPNAETYVIFGEAKVDDLSSQLQTQAAQRFKMPDVTSMLPNAGSEATM-APLAEEEDEDDVDDTGVEARDIDLVMTQAGVSKAKAVSALKANDGDIVSAIMELT 208          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA_ORENI (Nascent polypeptide-associated complex subunit alpha OS=Oreochromis niloticus GN=naca PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.423e-40
Identity = 87/136 (63.97%), Postives = 108/136 (79.41%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AM KLG++ + GV+RVT++KSKNILFVI+KPDV+KSP SDTYIVFGEAKIEDLS Q Q  AAE+FKVP     NV    ++  + +  ++EEVDETGVE KDIELVM+QA V R++AV+ALK  + DIV+AIMELT
Sbjct:   79 AMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVPGETVSNVQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNNNDIVNAIMELT 214          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA_DANRE (Nascent polypeptide-associated complex subunit alpha OS=Danio rerio GN=naca PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.683e-39
Identity = 85/136 (62.50%), Postives = 107/136 (78.68%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AM KLG++ + GV+RVT++KSKNILFVI+KPDV+KSP SDTYIVFGEAKIEDLS Q Q  AAE+FKV      N+    ++  + +  ++EEVDETGVE KDIELVM+QA V R++AV+ALK  + DIV+AIMELT
Sbjct:   79 AMSKLGLRQVAGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNNNDIVNAIMELT 214          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACAD_MOUSE (NAC-alpha domain-containing protein 1 OS=Mus musculus GN=Nacad PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 2.683e-39
Identity = 85/141 (60.28%), Postives = 106/141 (75.18%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVP-------PPNTGNVASKPESSAMVQDDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AM KLG++ I GV+R+T++KSKNILFVI+KPDVFKSP SDTY+VFGEAKIEDLS Q+   AAE+FKVP       P  +     +PE     ++DEEV+E G+EP+DIELVM QA V R++AV+ALK    DIV+AIMELT
Sbjct: 1363 AMSKLGLRQIQGVTRITIQKSKNILFVIAKPDVFKSPASDTYVVFGEAKIEDLSQQVHKAAAEKFKVPSEPSALVPELSPGPRVRPECEEQEEEDEEVEEAGLEPRDIELVMAQANVTRAKAVRALKDNHSDIVNAIMELT 1503          
BLAST of CX046735 vs. ExPASy Swiss-Prot
Match: NACA_XENTR (Nascent polypeptide-associated complex subunit alpha OS=Xenopus tropicalis GN=naca PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.504e-39
Identity = 85/136 (62.50%), Postives = 106/136 (77.94%), Query Frame = 1
Query:  271 AMLKLGMKPIPGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIVFGEAKIEDLSSQLQTQAAEQFKVPPPNTGNVASKPESSAMVQ--DDEEVDETGVEPKDIELVMTQAGVPRSRAVKALKAADGDIVSAIMELT 672
            AM KLG++ + GV+RVT++KSKNILFVI+KPDV+KSP SDTYIVFGEAKIEDLS Q Q  AAE+FKV      N+    ++  + +  ++EEVDETGVE KDIELVM+QA V R++AV+ALK    DIV+AIMELT
Sbjct:   78 AMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVQGEAVSNIQENTQTPTVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNSNDIVNAIMELT 213          
The following BLAST results are available for this feature:
BLAST of CX046735 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
NACA1_ARATH6.578e-5484.56Nascent polypeptide-associated complex subunit alp... [more]
NACA_PINTA1.122e-5382.96Nascent polypeptide-associated complex subunit alp... [more]
NACA3_ARATH6.807e-5180.14Nascent polypeptide-associated complex subunit alp... [more]
NACA2_ARATH2.266e-4668.57Nascent polypeptide-associated complex subunit alp... [more]
NACA4_ARATH1.243e-4468.57Nascent polypeptide-associated complex subunit alp... [more]
NACA5_ARATH2.345e-4364.03Nascent polypeptide-associated complex subunit alp... [more]
NACA_ORENI1.423e-4063.97Nascent polypeptide-associated complex subunit alp... [more]
NACA_DANRE2.683e-3962.50Nascent polypeptide-associated complex subunit alp... [more]
NACAD_MOUSE2.683e-3960.28NAC-alpha domain-containing protein 1 OS=Mus muscu... [more]
NACA_XENTR3.504e-3962.50Nascent polypeptide-associated complex subunit alp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_9H07_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-9H07-P13-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX046735 ID=CX046735|Name=CX046735|organism=Citrus sinensis|type=EST|length=856bp
TTTAGTCTTCTCTCTTTCGTGTCCGCTTCTCGTTCTCAAGTCTCAACACC
CAGCCCAAAAAAAATGACTGCTCAGTCTCAAGAAGAGCTCCTCGCTGCCC
ATCTTGAAGAGCAAAAGCTCAACCCCGATGAGCCTGTAGTCGAGGACGAC
GATGATGAGGATGATGATGAGGAGGATGAGGATGATGACAAGGATGAAGA
CGATGTGGAAGGGAAAGGAGATGGAAGTGGTCGCTCAAAACAGAGCAGGA
GTGAAAAGAAGAGTCGGAAAGCAATGTTGAAACTTGGAATGAAGCCAATC
CCTGGCGTCAGTCGAGTTACAGTTAAAAAGAGCAAAAATATTTTGTTTGT
TATCTCCAAACCAGATGTTTTCAAGAGTCCTACATCTGACACATACATTG
TCTTTGGGGAAGCAAAGATCGAGGATCTGAGTTCACAACTGCAAACTCAG
GCTGCAGAGCAGTTCAAGGTCCCTCCTCCTAACACAGGTAATGTGGCATC
AAAGCCTGAGTCATCGGCCATGGTTCAAGATGACGAAGAAGTAGATGAGA
CTGGTGTGGAGCCAAAGGACATTGAGTTGGTAATGACTCAAGCTGGGGTA
CCGAGGTCAAGGGCTGTGAAAGCACTCAAAGCCGCAGATGGTGACATCGT
TTCTGCCATTATGGAGCTAACAAATTGATGGTCACTTTCTTAATTATGTT
GCTCTGCTGAATGATCCCATAAGGAAATCTTTTTTTTTTTTTTTTCTCGC
TGTTACCATTTACAATTGAAGTTGCAGATTTTTGCTGGCTTTATAACTTT
TCTCTCTTTTTTTTCCCCTCTTTTTCCCTTGTGTATCAGCATGAAACAGC
TTTTAC
back to top