CX046731

Overview
NameCX046731
Unique NameCX046731
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length797
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CX046731_ssr350 microsatellite CX046731_ssr350:350..361. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig3801 contig Csv1_Contig3801:1..797. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL212_ARATH (60S ribosomal protein L21-2 OS=Arabidopsis thaliana GN=RPL21E PE=2 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 9.003e-71
Identity = 125/146 (85.62%), Postives = 135/146 (92.47%), Query Frame = -3
Query:  193 FLIKQTMATSTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLETVTPIPYDVVNDLKGGY 630
            F  K  +  STYLRT+K+GDYVDVKVNGA+HKGMPHKFYHGRTGR+WNVTKRA+GVE+NKQ+GNRII+KRIHVRVEHVQ SRC EEFKLRKK+ND LKADAKARGE ISTKRQPKGPKPGFMVEG TLETVTPIPYDVVNDLKGGY
Sbjct:   19 FRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKQNDVLKADAKARGETISTKRQPKGPKPGFMVEGMTLETVTPIPYDVVNDLKGGY 164          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL211_ARATH (60S ribosomal protein L21-1 OS=Arabidopsis thaliana GN=RPL21A PE=2 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 1.536e-70
Identity = 125/146 (85.62%), Postives = 134/146 (91.78%), Query Frame = -3
Query:  193 FLIKQTMATSTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLETVTPIPYDVVNDLKGGY 630
            F  K  +  STYLRT+K+GDYVDVKVNGA+HKGMPHKFYHGRTGR+WNVTKRA+GVE+NKQ+GNRII+KRIHVRVEHVQ SRC EEFKLRKKKNDELKA AKA GE ISTKRQPKGPKPGFMVEG TLETVTPIPYDVVNDLKGGY
Sbjct:   19 FRKKGYIPLSTYLRTFKVGDYVDVKVNGAIHKGMPHKFYHGRTGRIWNVTKRAVGVEVNKQIGNRIIRKRIHVRVEHVQQSRCAEEFKLRKKKNDELKAAAKANGETISTKRQPKGPKPGFMVEGMTLETVTPIPYDVVNDLKGGY 164          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21_CYAPA (60S ribosomal protein L21 OS=Cyanophora paradoxa GN=RPL21 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.895e-36
Identity = 82/141 (58.16%), Postives = 100/141 (70.92%), Query Frame = -3
Query:  220 AFLIKQTMATSTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAK-ARGEVISTKRQPKGPKPGFMV--EGATLETVTPIPYD 633
            AF     +  STYL  +KIG+YVDV  N AVHKGMP K+YHGRTG VWNVTKRAIGVEINK+V +RIIKKRIHVR++HV+ S C + F  R K+ND++K DA  A+  V STKR P  PK G ++  +G   ET   IPY+
Sbjct:   18 AFKTNGPVHLSTYLTNFKIGEYVDVVGNAAVHKGMPFKYYHGRTGIVWNVTKRAIGVEINKRVRHRIIKKRIHVRIDHVKKSSCRDSFLKRVKENDKIKHDAHVAKLPVPSTKRLPVLPKAGAIIKSKGQVPETCHAIPYE 158          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21_DICDI (60S ribosomal protein L21 OS=Dictyostelium discoideum GN=rpl21 PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.228e-35
Identity = 71/135 (52.59%), Postives = 93/135 (68.89%), Query Frame = -3
Query:  214 MATSTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLE--TVTPIPYDVV 612
            + T+T+LRT+++GDYVD+K  G VHKGMPHKFYHGRTGRVWNVT RA+GV INK+VG RII K+IHVR EHV+PS        R ++N +   +AK  G+ +  +R P  PK GF V     E   V P+ Y+++
Sbjct:   25 LQTTTFLRTFRLGDYVDIKATGNVHKGMPHKFYHGRTGRVWNVTPRAVGVIINKRVGPRIIAKKIHVRTEHVKPSNSMAAHLKRIQENKKAVVEAKKAGKWVDVRRNPAAPKDGFFVNPRNTEFVEVKPVKYELL 159          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21A_YEAST (60S ribosomal protein L21-A OS=Saccharomyces cerevisiae GN=RPL21A PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.667e-35
Identity = 68/130 (52.31%), Postives = 96/130 (73.85%), Query Frame = -3
Query:  220 STYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMV--EGATLETVTPIPYD 603
            STYL+ YK+GD VD+K NG++ KGMPHKFY G+TG V+NVTK ++GV INK VGNR ++KR+++RVEH++ S+C +EF  R K N   +A+AKA+G  +  KRQP  P+   +V  EG   +T+ P+PY+
Sbjct:   28 STYLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKCRQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTLAPVPYE 157          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21B_YEAST (60S ribosomal protein L21-B OS=Saccharomyces cerevisiae GN=RPL21B PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 6.095e-35
Identity = 68/130 (52.31%), Postives = 96/130 (73.85%), Query Frame = -3
Query:  220 STYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMV--EGATLETVTPIPYD 603
            STYL+ YK+GD VD+K NG++ KGMPHKFY G+TG V+NVTK ++GV INK VGNR ++KR+++RVEH++ S+C +EF  R K N   +A+AKA+G  +  KRQP  P+   +V  EG   +T+ P+PY+
Sbjct:   28 STYLKIYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKCRQEFLERVKANAAKRAEAKAQGVAVQLKRQPAQPRESRIVSTEGNVPQTLAPVPYE 157          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21B_SCHPO (60S ribosomal protein L21-B OS=Schizosaccharomyces pombe GN=rpl21b PE=2 SV=2)

HSP 1 Score: 144.05 bits (362), Expect = 8.802e-34
Identity = 68/130 (52.31%), Postives = 94/130 (72.31%), Query Frame = -3
Query:  220 STYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLETVT--PIPYD 603
            STYL+TYK+GD VD+KVNGAV KGMPHK+YHG+TG V+NVT+ ++GV I K VGNR ++KR++VR+EHV+ S+C ++F  R K N+  + +AKA+G+ +  +RQP  P     V     E VT  P+ YD
Sbjct:   28 STYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVYNVTQSSVGVLIYKVVGNRYMEKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRRQPAPPATAHFVSTENNEPVTLHPVAYD 157          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21A_SCHPO (60S ribosomal protein L21-A OS=Schizosaccharomyces pombe GN=rpl21a PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.802e-34
Identity = 68/130 (52.31%), Postives = 94/130 (72.31%), Query Frame = -3
Query:  220 STYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMVEGATLETVT--PIPYD 603
            STYL+TYK+GD VD+KVNGAV KGMPHK+YHG+TG V+NVT+ ++GV I K VGNR ++KR++VR+EHV+ S+C ++F  R K N+  + +AKA+G+ +  +RQP  P     V     E VT  P+ YD
Sbjct:   28 STYLKTYKVGDIVDIKVNGAVQKGMPHKYYHGKTGVVYNVTQSSVGVLIYKVVGNRYMEKRVNVRIEHVKHSKCRQDFLDRVKANEAKRKEAKAQGKTVQLRRQPAPPAKAHFVSTENNEPVTLHPVAYD 157          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21_HUMAN (60S ribosomal protein L21 OS=Homo sapiens GN=RPL21 PE=1 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 4.089e-31
Identity = 64/130 (49.23%), Postives = 89/130 (68.46%), Query Frame = -3
Query:  220 STYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMV--EGATLETVTPIPYD 603
            +TY+R YK GD VD+K  G V KGMPHK YHG+TGRV+NVT+ A+G+ +NKQV  +I+ KRI+VR+EH++ S+  + F  R K+ND+ K +AK +G  +  KRQP  P+    V   G   E + PIPY+
Sbjct:   28 ATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLEPIPYE 157          
BLAST of CX046731 vs. ExPASy Swiss-Prot
Match: RL21_CHILA (60S ribosomal protein L21 OS=Chinchilla lanigera GN=RPL21 PE=2 SV=3)

HSP 1 Score: 135.191 bits (339), Expect = 4.089e-31
Identity = 64/130 (49.23%), Postives = 89/130 (68.46%), Query Frame = -3
Query:  220 STYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVEINKQVGNRIIKKRIHVRVEHVQPSRCTEEFKLRKKKNDELKADAKARGEVISTKRQPKGPKPGFMV--EGATLETVTPIPYD 603
            +TY+R YK GD VD+K  G V KGMPHK YHG+TGRV+NVT+ A+G+ +NKQV  +I+ KRI+VR+EH++ S+  + F  R K+ND+ K +AK +G  +  KRQP  P+    V   G   E + PIPY+
Sbjct:   28 ATYMRIYKKGDIVDIKGMGTVQKGMPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSKSRDSFLKRVKENDQKKKEAKEKGTWVQLKRQPAPPREAHFVRTNGKEPELLEPIPYE 157          
The following BLAST results are available for this feature:
BLAST of CX046731 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 17
Match NameE-valueIdentityDescription
RL212_ARATH9.003e-7185.6260S ribosomal protein L21-2 OS=Arabidopsis thalian... [more]
RL211_ARATH1.536e-7085.6260S ribosomal protein L21-1 OS=Arabidopsis thalian... [more]
RL21_CYAPA1.895e-3658.1660S ribosomal protein L21 OS=Cyanophora paradoxa G... [more]
RL21_DICDI1.228e-3552.5960S ribosomal protein L21 OS=Dictyostelium discoid... [more]
RL21A_YEAST4.667e-3552.3160S ribosomal protein L21-A OS=Saccharomyces cerev... [more]
RL21B_YEAST6.095e-3552.3160S ribosomal protein L21-B OS=Saccharomyces cerev... [more]
RL21B_SCHPO8.802e-3452.3160S ribosomal protein L21-B OS=Schizosaccharomyces... [more]
RL21A_SCHPO8.802e-3452.3160S ribosomal protein L21-A OS=Schizosaccharomyces... [more]
RL21_HUMAN4.089e-3149.2360S ribosomal protein L21 OS=Homo sapiens GN=RPL21... [more]
RL21_CHILA4.089e-3149.2360S ribosomal protein L21 OS=Chinchilla lanigera G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_9H05_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-9H05-P9-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX046731 ID=CX046731|Name=CX046731|organism=Citrus sinensis|type=EST|length=797bp
TTTTTTTTTTTTTTTTTCGGAAAACATCTCTTGTTTCTAATATAAAATGA
AGATTAAAAATAAACATCTCTGCAATTGCAGTTCCTCTCCAAAAACAAAA
CTAATAAGGATGAAAATACATCCAAATAAGACCATGTCCAGAAAAGTCTG
CAACAAGTAACAAAACAGCAACAATACCAAAAAGATAACCTAGTAACCAC
CCTTAAGATCATTGACGACATCATAAGGAATAGGAGTGACAGTTTCCAAT
GTTGCACCTTCCACCATGAAACCTGGTTTAGGGCCCTTTGGCTGCCTCTT
TGTACTGATGACCTCACCTCTTGCCTTAGCATCTGCCTTGAGCTCATCAT
TCTTCTTCTTCCTCAGCTTGAACTCCTCGGTACACCTTGAAGGTTGAACA
TGCTCCACACGAACATGAATCCTCTTCTTGATGATCCTGTTACCAACCTG
CTTGTTAATCTCCACGCCGATGGCGCGCTTGGTGACATTCCAGACACGGC
CTGTACGCCCATGGTAGAACTTGTGGGGCATACCTTTGTGAACGGCGCCG
TTCACTTTGACGTCAACGTAGTCGCCGATTTTGTAAGTCCTAAGGTAAGT
GGACGTTGCCATAGTTTGCTTAATTAAAAAGGCTACCCCAGACAAGCCGT
AGTGTATGTATAGTTATACAAAAGGCAAAAAAACTTACCCATTTGCCCAA
ATTCCAATCTTTTTCACAAGCTAGGCAAGAAGCAGCAGCCATGAAAGGTT
CCAAAGTGAAGCCACCATTTTCATTTTCAGCCATTTTGTTGCTGGTT
back to top