CX046729

Overview
NameCX046729
Unique NameCX046729
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length802
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3800 contig Csv1_Contig3800:1..800. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: SCL3_ARATH (Scarecrow-like protein 3 OS=Arabidopsis thaliana GN=SCL3 PE=2 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.267e-88
Identity = 173/295 (58.64%), Postives = 214/295 (72.54%), Query Frame = 2
Query:    2 NHVXXXXXXXXXXXXDQISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNST--RISSVSEEMLVRKLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAISSVLQLHSLLAADD---------------------------YASLIALKNSLLANGYGYXXXXXXXXXXXXXXXXXAKMDSFLNSLWGLSPKVMVVTEQDSNHHG 799
            NHV            +Q+S LASPDGDTMQRIAAYFTEALA RILKSWPGL+KALN+T  R ++VSEE+ VR+LFF+MFP LKV+++LTN+AI+EAMEGEK+VHVIDL+A+EPAQW+AL+QA ++RPEGPPHLRITG+H QKEVL+QMAHRL EEAEKLDIPFQFN VVS+L+ L+ ++LRVKTGEALA+SSVLQLH+ LA+DD                           + S    + + ++N  GY                  + DSFLN++WGLSPKVMVVTEQDS+H+G
Sbjct:   63 NHVASGSLQNANAALEQLSHLASPDGDTMQRIAAYFTEALANRILKSWPGLYKALNATQTRTNNVSEEIHVRRLFFEMFPILKVSYLLTNRAILEAMEGEKMVHVIDLDASEPAQWLALLQAFNSRPEGPPHLRITGVHHQKEVLEQMAHRLIEEAEKLDIPFQFNPVVSRLDCLNVEQLRVKTGEALAVSSVLQLHTFLASDDDLMRKNCALRFQNNPSGVDLQRVLMMSHGSAAEARENDMSNNNGY--SPSGDSASSLPLPSSGRTDSFLNAIWGLSPKVMVVTEQDSDHNG 355          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: SCR_ARATH (Protein SCARECROW OS=Arabidopsis thaliana GN=SCR PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 4.581e-30
Identity = 70/174 (40.23%), Postives = 108/174 (62.07%), Query Frame = 2
Query:   50 QISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVR--KLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAI 565
            +ISQL++P G + QR+AAYF+EA++ R+L S  G++ AL S  +       +V   ++F  + P +K +    NQAI EA E E  VH+IDL+  +  QW  L   L++RP GPPH+R+TG+    E L     RL++ A+KL +PF+F  +  K+ NLD ++L V+  EA+A+
Sbjct:  315 EISQLSTPYGTSAQRVAAYFSEAMSARLLNSCLGIYAALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTANQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGTSMEALQATGKRLSDFADKLGLPFEFCPLAEKVGNLDTERLNVRKREAVAV 488          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: SCR_PEA (Protein SCARECROW OS=Pisum sativum GN=SCR PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.969e-29
Identity = 67/173 (38.73%), Postives = 110/173 (63.58%), Query Frame = 2
Query:   50 QISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVR-KLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAI 565
            +ISQL++P G + QR+AAYF+EA++ R++ S  G++  L  +  +  ++++    ++F  + PF+K +    NQAI EA E E+ VH+IDL+  +  QW  L   L++RP GPP++R+TG+    E L+    RL++ A KL +PF+F  V  K+ N+D +KL V   EA+A+
Sbjct:  472 EISQLSTPFGTSAQRVAAYFSEAISARLVSSCLGIYATLPVSSHTPHNQKVASAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPYVRLTGLGTSMETLEATGKRLSDFANKLGLPFEFFPVAEKVGNIDVEKLNVSKSEAVAV 644          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: GAI1_VITVI (DELLA protein GAI1 OS=Vitis vinifera GN=GAI1 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.614e-29
Identity = 82/255 (32.16%), Postives = 132/255 (51.76%), Query Frame = 2
Query:   50 QISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVRKLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHP----QKEVLDQMAHRLTEEAEKLDIPFQFNS-VVSKLENLDFDKLRVKTGEALAISSVLQLHSLLAADDYASLIALKNSLLANGYGYXXXXXXXXXXXXXXXXXAKMDSFLNSLWGLSPKVMVVTEQDSNHHG 799
            QI  LA      M+++A YF E LA+RI + +P   K L+S      S   +++  F++  P+LK A    NQAI+EA EG+K VHVID +  +  QW AL+QAL+ RP GPP  R+TGI P      + L ++  +L + AE + + F++   V + L +LD   L ++ GE++A++SV +LHSLLA                                        ++  L+++  + P ++ + EQ++NH+G
Sbjct:  239 QIGFLAVSQAGAMRKVATYFAEGLARRIYRLYPD--KPLDS------SFSDILQMHFYETCPYLKFAHFTANQAILEAFEGKKRVHVIDFSMKQGMQWPALMQALALRPGGPPSFRLTGIGPPSTDNTDHLHEVGWKLAQLAETIHVEFEYRGFVANSLADLDASMLELRDGESVAVNSVFELHSLLA------------------------------------RPGGIERVLSAVKDMKPDIVTIVEQEANHNG 449          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: SCR_IPONI (Protein SCARECROW OS=Ipomoea nil GN=SCR PE=1 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.128e-28
Identity = 85/255 (33.33%), Postives = 130/255 (50.98%), Query Frame = 2
Query:   50 QISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKA--LNSTRISSVSEEMLVRKLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAISSVLQLHSLLAADDYASLIALKNSLLANGYGYXXXXXXXXXXXXXXXXXAKMDSFLNSLW---GLSPKVMVVTEQDSNHHG 799
            Q+S+L++P G + QR+AAYF+EA++ R++ S  G++ +  LN+  +S   +     ++F  + PF+K +    NQAI EA E E  VH+IDL+  +  QW  L   L++RP GPP +R+TG+    E L+    RL++ A+KL +PF+F  V  K+ NLD  +L V   EA+A+  +   HSL                                            S  N+LW    L+PKV+ V EQD +H G
Sbjct:  442 QVSELSTPYGTSAQRVAAYFSEAMSARLVNSCLGIYASAPLNALPLSLNQKMASAFQVFNGISPFVKFSHFTANQAIQEAFEREDRVHIIDLDIMQGLQWPGLFHILASRPGGPPLVRLTGLGTSMEALEATGKRLSDFAQKLGLPFEFFPVADKVGNLDPQRLNVNKREAVAVHWL--QHSLYDV---------------------------------------TGSDTNTLWLLQRLAPKVVTVVEQDLSHAG 655          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: PAT1_ARATH (Scarecrow-like transcription factor PAT1 OS=Arabidopsis thaliana GN=PAT1 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.128e-27
Identity = 76/254 (29.92%), Postives = 123/254 (48.43%), Query Frame = 2
Query:   47 DQISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVRKLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEV------LDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAISSVLQLHSLLAADDYASLIALKNSLLANGYGYXXXXXXXXXXXXXXXXXAKMDSFLNSLWGLSPKVMVVTEQDSN 790
            +++ Q+ S  G+ +QR+ AY  E L  ++  S   ++KALN     + +E +    + +++ P+ K  ++  N AI EAM+ E  VH+ID    + +QW+ LIQA + RP GPP +RITGI            L  + +RL + A++ ++PF+FNSV   +  +    L V+ GEALA++    LH +   D+  S                                   D  L  +  LSPKV+ + EQ+SN
Sbjct:  143 EKLRQMVSVSGEPIQRLGAYLLEGLVAQLASSGSSIYKALNRCPEPASTELLSYMHILYEVCPYFKFGYMSANGAIAEAMKEENRVHIIDFQIGQGSQWVTLIQAFAARPGGPPRIRITGIDDMTSAYARGGGLSIVGNRLAKLAKQFNVPFEFNSVSVSVSEVKPKNLGVRPGEALAVNFAFVLHHM--PDESVS------------------------------TENHRDRLLRMVKSLSPKVVTLVEQESN 364          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: SCR2_ORYSJ (Protein SCARECROW 2 OS=Oryza sativa subsp. japonica GN=SCR2 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 2.779e-27
Identity = 69/175 (39.43%), Postives = 104/175 (59.43%), Query Frame = 2
Query:   50 QISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVR---KLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAI 565
            +I++LA+P G + QR+AAYF EA++ R++ S  GL+  L S   +       V    ++F  + PF+K +    NQAI EA E E+ VH+IDL+  +  QW  L   L++RP GPP +R+TG+    E L+    RL++ A+ L +PF+F  V  K  NLD +KL V   EA+A+
Sbjct:  317 EIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPSPSPAGARVHGRVAAAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGASMEALEATGKRLSDFADTLGLPFEFCPVADKAGNLDPEKLGVTRREAVAV 491          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: SCR2_ORYSI (Protein SCARECROW 2 OS=Oryza sativa subsp. indica GN=SCR2 PE=3 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 2.779e-27
Identity = 69/175 (39.43%), Postives = 104/175 (59.43%), Query Frame = 2
Query:   50 QISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVR---KLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAI 565
            +I++LA+P G + QR+AAYF EA++ R++ S  GL+  L S   +       V    ++F  + PF+K +    NQAI EA E E+ VH+IDL+  +  QW  L   L++RP GPP +R+TG+    E L+    RL++ A+ L +PF+F  V  K  NLD +KL V   EA+A+
Sbjct:  317 EIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPSPSPAGARVHGRVAAAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGASMEALEATGKRLSDFADTLGLPFEFCPVADKAGNLDPEKLGVTRREAVAV 491          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: RGL1_ARATH (DELLA protein RGL1 OS=Arabidopsis thaliana GN=RGL1 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.629e-27
Identity = 78/251 (31.08%), Postives = 126/251 (50.20%), Query Frame = 2
Query:   53 ISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVRKLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSV-VSKLENLDFDKLRVKTG-EALAISSVLQLHSLLAADDYASLIALKNSLLANGYGYXXXXXXXXXXXXXXXXXAKMDSFLNSLWGLSPKVMVVTEQDSNHHG 799
            +  LAS     M+++A YF E LA+RI + +P      +   +SS S+ + +   F++  P+LK A    NQAI+E     + VHVIDL      QW ALIQAL+ RP GPP  R+TGI      + ++  +L + A  + + F+F S+ ++ L +L  + L ++ G E++A++SV +LH LLA                                        +D FL+++  + P +M V EQ++NH+G
Sbjct:  178 VGLLASSQAGAMRKVATYFAEGLARRIYRIYPR-----DDVALSSFSDTLQIH--FYESCPYLKFAHFTANQAILEVFATAEKVHVIDLGLNHGLQWPALIQALALRPNGPPDFRLTGIGYSLTDIQEVGWKLGQLASTIGVNFEFKSIALNNLSDLKPEMLDIRPGLESVAVNSVFELHRLLA------------------------------------HPGSIDKFLSTIKSIRPDIMTVVEQEANHNG 385          
BLAST of CX046729 vs. ExPASy Swiss-Prot
Match: SCR1_ORYSJ (Protein SCARECROW 1 OS=Oryza sativa subsp. japonica GN=SCR1 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 6.191e-27
Identity = 68/175 (38.86%), Postives = 105/175 (60.00%), Query Frame = 2
Query:   50 QISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRISSVSEEMLVR---KLFFDMFPFLKVAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHPQKEVLDQMAHRLTEEAEKLDIPFQFNSVVSKLENLDFDKLRVKTGEALAI 565
            +I++LA+P G + QR+AAYF EA++ R++ S  GL+  L +   ++      V    ++F  + PF+K +    NQAI EA E E+ VH+IDL+  +  QW  L   L++RP GPP +R+TG+    E L+    RL++ A+ L +PF+F  V  K  NLD +KL V   EA+A+
Sbjct:  308 EIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPNPSPAAARLHGRVAAAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGLFHILASRPGGPPRVRLTGLGASMEALEATGKRLSDFADTLGLPFEFCPVADKAGNLDPEKLGVTRREAVAV 482          
The following BLAST results are available for this feature:
BLAST of CX046729 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 52
Match NameE-valueIdentityDescription
SCL3_ARATH1.267e-8858.64Scarecrow-like protein 3 OS=Arabidopsis thaliana G... [more]
SCR_ARATH4.581e-3040.23Protein SCARECROW OS=Arabidopsis thaliana GN=SCR P... [more]
SCR_PEA2.969e-2938.73Protein SCARECROW OS=Pisum sativum GN=SCR PE=2 SV=... [more]
GAI1_VITVI6.614e-2932.16DELLA protein GAI1 OS=Vitis vinifera GN=GAI1 PE=2 ... [more]
SCR_IPONI1.128e-2833.33Protein SCARECROW OS=Ipomoea nil GN=SCR PE=1 SV=1[more]
PAT1_ARATH2.128e-2729.92Scarecrow-like transcription factor PAT1 OS=Arabid... [more]
SCR2_ORYSJ2.779e-2739.43Protein SCARECROW 2 OS=Oryza sativa subsp. japonic... [more]
SCR2_ORYSI2.779e-2739.43Protein SCARECROW 2 OS=Oryza sativa subsp. indica ... [more]
RGL1_ARATH3.629e-2731.08DELLA protein RGL1 OS=Arabidopsis thaliana GN=RGL1... [more]
SCR1_ORYSJ6.191e-2738.86Protein SCARECROW 1 OS=Oryza sativa subsp. japonic... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS07_9H04_b Parent Washington Navel Orange Thrip-Challenged Flavedo cDNA Library UCRCS07 Citrus sinensis cDNA clone UCRCS07-9H04-P7-1-7.b, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CX046729 ID=CX046729|Name=CX046729|organism=Citrus sinensis|type=EST|length=802bp
AAATCATGTAGCAAATGGTAATCTTGAAAATGCTAATCTTGCTCTAGACC
AAATCTCGCAACTCGCCTCTCCTGATGGTGACACCATGCAACGCATTGCT
GCCTACTTTACCGAGGCACTTGCTCAAAGAATCCTCAAATCTTGGCCTGG
CCTTCACAAGGCCCTCAATTCCACTAGAATTAGTTCAGTTTCTGAAGAAA
TGCTTGTTCGGAAACTGTTTTTTGATATGTTCCCGTTCTTGAAAGTGGCT
TTTGTGCTCACAAATCAAGCTATTATTGAAGCAATGGAAGGGGAAAAGGT
GGTTCATGTGATTGATCTAAATGCAGCTGAGCCTGCACAGTGGATTGCAC
TCATTCAAGCTTTGAGTACAAGGCCTGAGGGGCCACCTCATTTGAGAATC
ACGGGGATTCATCCACAGAAGGAGGTGTTGGATCAAATGGCTCATAGATT
GACCGAAGAAGCAGAGAAATTGGATATCCCTTTCCAATTCAATTCAGTGG
TTAGCAAATTAGAAAATCTTGATTTTGACAAATTGAGAGTTAAAACCGGT
GAGGCTCTCGCGATCAGTTCTGTTCTTCAGCTGCATTCCCTTTTGGCCGC
TGATGATTATGCCTCCTTGATAGCATTGAAGAATTCCCTTTTGGCTAATG
GGTATGGGTATAGCCAGAGTCCTGATTCAGTCTCATCATCGCCTCTGTCT
CCAAATGCTTCAGCAAAGATGGACAGCTTTCTTAATTCTCTGTGGGGCTT
GTCACCAAAAGTTATGGTGGTGACAGAACAGGATTCTAATCACCATGGCT
TG
back to top