DN617306

Overview
NameDN617306
Unique NameDN617306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length523
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DN617306 vs. ExPASy Swiss-Prot
Match: CSLE6_ORYSJ (Cellulose synthase-like protein E6 OS=Oryza sativa subsp. japonica GN=CSLE6 PE=2 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.738e-21
Identity = 56/120 (46.67%), Postives = 76/120 (63.33%), Query Frame = -3
Query:  162 QRIWMIKSVTAHFYGSMDTILKLLGLRKASFLPTNKVLDKEQVKRYEIGQFDFQTSSMFLVPMVSLMILNMAALLFGFIRIIAVGNWDKLFAQVLLSLYILIINFAIVEGMIVRKDKGRI 521
            QR+WM+K +T++ YG +DTI KLLGL K SF  T KV D ++ KRYE    +F +SS   V + ++ +LN   L+ G  +I+A G W+    QV+L   I+I N  I E M VRKDKGRI
Sbjct:  589 QRMWMVKRITSYLYGFIDTIRKLLGLSKMSFEITAKVSDGDEAKRYEQEILEFGSSSPEFVIIATVALLNFVCLVAGLSKIMA-GVWNVFLPQVILCGLIVITNIPIYEAMFVRKDKGRI 707          
BLAST of DN617306 vs. ExPASy Swiss-Prot
Match: CSLE1_ORYSJ (Cellulose synthase-like protein E1 OS=Oryza sativa subsp. japonica GN=CSLE1 PE=2 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 1.736e-18
Identity = 53/126 (42.06%), Postives = 77/126 (61.11%), Query Frame = -3
Query:  153 QRIWMIKSVTAHFYGSMDTILKLLGLRKASFLPTNKVLDKEQVKRYEIGQFDFQTSSMFLVPMVSLMILNMAALLFGFIRIIA-VGN--WDKLFAQVLLSLYILIINFAIVEGMIVRKDKGRISTS 521
            QR+WM+KS+T++ YG +DTI K +G+ K SF  T KV   ++ KRYE    +F +SS   V + ++ +LN   L+ G  +I+A V N  W+    Q +L   I+IIN  I E M +RKD GRI T+
Sbjct:  594 QRMWMVKSITSYLYGFIDTIRKCVGMSKMSFEVTAKVSGHDEAKRYEQEILEFGSSSPEYVIIATVALLNFVCLVGGLSQIMAGVWNMPWNVFLPQAILCGMIVIINMPIYEAMFLRKDNGRIPTA 719          
BLAST of DN617306 vs. ExPASy Swiss-Prot
Match: CSLE2_ORYSJ (Cellulose synthase-like protein E2 OS=Oryza sativa subsp. japonica GN=CSLE2 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.053e-15
Identity = 39/126 (30.95%), Postives = 76/126 (60.32%), Query Frame = -3
Query:  153 QRIWMIKSVTAHFYGSMDTILKLLGLRKASFLPTNKVLDKEQVKRYEIGQFDFQTSSMFLVPMVSLMILNMAALLFGFIRII---AVGNWDKLFAQVLLSLYILIINFAIVEGMIVRKDKGRISTS 521
            QR+W+I+ +T++   ++DT  ++LG+ ++ F  T KV D + ++RY+ G  +F + S   V + ++ +LN+A ++ G  R++     G  + LF Q +L + I+ IN  + E + +R+DKG +  S
Sbjct:  601 QRMWLIRRITSYLLATIDTFRRILGISESGFNLTVKVTDLQALERYKKGMMEFGSFSAMFVILTTVALLNLACMVLGISRVLLQEGPGGLETLFLQAVLCVLIVAINSPVYEALFLRRDKGSLPAS 726          
BLAST of DN617306 vs. ExPASy Swiss-Prot
Match: CSLG1_ARATH (Cellulose synthase-like protein G1 OS=Arabidopsis thaliana GN=CSLG1 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.288e-13
Identity = 44/122 (36.07%), Postives = 73/122 (59.84%), Query Frame = -3
Query:  159 QRIWMIKSVTAHFYGSMDTILKLLGLRKASFLPTNKVLDK-EQVKRYEIGQFDFQTSSMFLVPMVSLMILNMAALLFGFIRIIAVGNWDKLFAQVLLSLYILIINFAIVEGMIVRKDKGRIS 521
            QR+ MIK +++ F+G ++ ILK L L    F  T+K  D  EQ KRYE   FDF TSS   +P+ ++ I+N+ A ++G   I+  G   +L+ +++L  + ++    I   M++RKD G++S
Sbjct:  590 QRMLMIKGLSSFFFGFIEFILKTLNLSTPKFNVTSKANDDDEQRKRYEQEIFDFGTSSSMFLPLTTVAIVNLLAFVWGLYGILFCGG--ELYLELMLVSFAVVNCLPIYGAMVLRKDDGKLS 709          
BLAST of DN617306 vs. ExPASy Swiss-Prot
Match: CSLE1_ARATH (Cellulose synthase-like protein E1 OS=Arabidopsis thaliana GN=CSLE1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 2.429e-12
Identity = 36/125 (28.80%), Postives = 76/125 (60.80%), Query Frame = -3
Query:  153 QRIWMIKSVTAHFYGSMDTILKLLGLRKASFLPTNKVLDKEQVKRYEIGQFDFQTSSMFLVPMVSLMILNMAALLFGFIRIIA--VGNWDKLFAQVLLSLYILIINFAIVEGMIVRKDKGRISTS 521
            QR+W+ +  ++  +G MDTI KLLG+ +++F+ T KV ++E  +RY+    +F   S   + + +L +LN+        R+++   G+   +  Q +++  +++IN+ + +GM++R+DKG++  S
Sbjct:  586 QRMWLYRRTSSFLFGFMDTIKKLLGVSESAFVITAKVAEEEAAERYKEEVMEFGVESPMFLVLGTLGMLNLFCFAAAVARLVSGDGGDLKTMGMQFVITGVLVVINWPLYKGMLLRQDKGKMPMS 710          
BLAST of DN617306 vs. ExPASy Swiss-Prot
Match: CSLG3_ARATH (Cellulose synthase-like protein G3 OS=Arabidopsis thaliana GN=CSLG3 PE=2 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 7.066e-12
Identity = 39/121 (32.23%), Postives = 70/121 (57.85%), Query Frame = -3
Query:  162 QRIWMIKSVTAHFYGSMDTILKLLGLRKASFLPTNKVLD-KEQVKRYEIGQFDFQTSSMFLVPMVSLMILNMAALLFGFIRIIAVGNWDKLFAQVLLSLYILIINFAIVEGMIVRKDKGRI 521
            QR+W I+  ++H +G ++  LK L L    F  T+K  D +EQ KRYE   F+F  SS   +P+ ++ I+N+ A ++G   + A G  + L  +++L+ + ++    I E M++R D G++
Sbjct:  609 QRMWSIRGFSSHLFGFIEFTLKTLNLSTHGFNVTSKANDDEEQSKRYEKEIFEFGPSSSMFLPLTTVAIVNLLAFVWGLYGLFAWG--EGLVLELMLASFAVVNCLPIYEAMVLRIDDGKL 727          
BLAST of DN617306 vs. ExPASy Swiss-Prot
Match: CSLG2_ARATH (Cellulose synthase-like protein G2 OS=Arabidopsis thaliana GN=CSLG2 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.056e-11
Identity = 39/121 (32.23%), Postives = 68/121 (56.20%), Query Frame = -3
Query:  162 QRIWMIKSVTAHFYGSMDTILKLLGLRKASFLPTNKVLD-KEQVKRYEIGQFDFQTSSMFLVPMVSLMILNMAALLFGFIRIIAVGNWDKLFAQVLLSLYILIINFAIVEGMIVRKDKGRI 521
            QR+WM++ +++ F+G  +  LK L L    +  T+K  D  EQ+KRYE   FDF  SS   +P+ ++ I+N+ A + G   I   G    L  +++L+ + ++    I E M++R D G++
Sbjct:  580 QRMWMVRGLSSFFFGFTEFTLKTLNLSTQGYNVTSKSNDDNEQMKRYEQEIFDFGPSSSMFLPITTVAIMNLLAFMRGLYGIFTWGEGPVL--ELMLASFAVVNCLPIYEAMVLRIDDGKL 698          
The following BLAST results are available for this feature:
BLAST of DN617306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
CSLE6_ORYSJ3.738e-2146.67Cellulose synthase-like protein E6 OS=Oryza sativa... [more]
CSLE1_ORYSJ1.736e-1842.06Cellulose synthase-like protein E1 OS=Oryza sativa... [more]
CSLE2_ORYSJ1.053e-1530.95Cellulose synthase-like protein E2 OS=Oryza sativa... [more]
CSLG1_ARATH1.288e-1336.07Cellulose synthase-like protein G1 OS=Arabidopsis ... [more]
CSLE1_ARATH2.429e-1228.80Cellulose synthase-like protein E1 OS=Arabidopsis ... [more]
CSLG3_ARATH7.066e-1232.23Cellulose synthase-like protein G3 OS=Arabidopsis ... [more]
CSLG2_ARATH2.056e-1132.23Cellulose synthase-like protein G2 OS=Arabidopsis ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A13_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617306 ID=DN617306|Name=DN617306|organism=Citrus sinensis|type=EST|length=523bp
TTTTTTTTTAACAAAAATTTAATTATTTTATTTGCTTTGCCTGTGGCAAT
TAAGATAAAATGAAACACTCTACATTTTGCTTATAGCTACATAAGAATGA
TAGACCCAAAGAACAATAAAATCACGGAAAATACACTTGATAATAAAATG
GCTGATGTTGAAATCCTTCCCTTGTCCTTTCTCACTATCATCCCTTCAAC
AATTGCAAAATTGATGATCAAGATGTAGAGTGAGAGCAACACCTGCGCAA
ATAATTTGTCCCAGTTGCCCACAGCAATTATTCTGATAAACCCAAAAAGC
AAGGCTGCCATGTTCAGAATCATCAAAGAAACCATTGGAACAAGAAACAT
AGAGGATGTTTGAAAATCAAATTGGCCTATTTCATATCTTTTGACTTGTT
CTTTATCCAAAACCTTGTTGGTTGGCAGGAAACTGGCTTTCCTCAAGCCA
AGAAGTTTCAAAATAGTATCCATACTTCCATAGAAATGAGCTGTGACAGA
CTTTATCATCCAAATTCTCTGCT
back to top