DN135097

Overview
NameDN135097
Unique NameDN135097
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length565
Libraries
Library NameType
Mature Juice Sac from Navel Orange in pTriplEx2 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN135097_ssr184 microsatellite DN135097_ssr184:184..195. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2674 contig Csv1_Contig2674:21..585. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN135097 vs. ExPASy Swiss-Prot
Match: GTOMC_ARATH (Tocopherol O-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=G-TMT PE=2 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 1.810e-38
Identity = 82/136 (60.29%), Postives = 98/136 (72.06%), Query Frame = 3
Query:  114 RSSLLFGVSSFSRKLIXXXXXXXXXXXXXXXXXRELKEGIAEFYDESSSLWEDIWGDHMHHGFYEPDSSVSVSD--HRAAQVRMIEETLRFAGVS-EDPTKRPKNVVDVGCGIGGSSRYLAKKFGAKCQGITLSPV 512
            +SSLLF   S S  +                    L++GIAEFY+E+S LWE+IWGDHMHHGFY+PDSSV +SD  H+ AQ+RMIEE+LRFAGV+ E+  K+ K VVDVGCGIGGSSRYLA KFGA+C GITLSPV
Sbjct:   25 KSSLLFRSPSSSSSVSMTTTRGNVAVAAAATSTEALRKGIAEFYNETSGLWEEIWGDHMHHGFYDPDSSVQLSDSGHKEAQIRMIEESLRFAGVTDEEEEKKIKKVVDVGCGIGGSSRYLASKFGAECIGITLSPV 160          
The following BLAST results are available for this feature:
BLAST of DN135097 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
GTOMC_ARATH1.810e-3860.29Tocopherol O-methyltransferase, chloroplastic OS=A... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca06b10 Mature Juice Sac from Navel Orange in pTriplEx2 vector Citrus sinensis cDNA clone wca06b10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN135097 ID=DN135097|Name=DN135097|organism=Citrus sinensis|type=EST|length=565bp
GGGGATTCTTTCCTGGAAGAAAAAAAGAAAAAAGGCTCTCCGACATNNNA
TCAGAAATGTCCGCGTGTCTCCGCCCTTCCCTCCTCCCAGCCCCTCCTCC
GGCTCCTACGTGGCGAAGTTCCCTGCTTTTTGGAGTGAGCTCTTTCTCGA
GGAAGCTAATAACTCGAGCGTCATCTACGACGTCGACGACGACGATGAGT
GACGCTGCCGCACGTGAGCTGAAAGAAGGAATAGCTGAGTTCTACGACGA
GTCGTCTAGCCTTTGGGAGGACATTTGGGGCGACCACATGCACCACGGAT
TCTACGAGCCGGATTCCTCCGTCTCCGTCTCCGACCACCGCGCCGCCCAG
GTCCGCATGATCGAAGAGACGCTCCGTTTCGCCGGCGTTTCCGAGGACCC
AACGAAGAGGCCAAAGAATGTTGTGGATGTTGGCTGTGGGATAGGAGGCA
GCTCTAGATACTTGGCTAAGAAATTTGGCGCTAAATGCCAAGGCATCACT
CTCAGTCCCGTCCAAGCACAGAGGGCTAATGCCCTTGCTGCTGCTCGAGG
CTTAGCCGATAAGGT
back to top