DN134859

Overview
NameDN134859
Unique NameDN134859
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length413
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6283 contig Csv1_Contig6283:895..1308. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_WHEAT (Photosystem II reaction center protein I OS=Triticum aestivum GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_VITVI (Photosystem II reaction center protein I OS=Vitis vinifera GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_TOBAC (Photosystem II reaction center protein I OS=Nicotiana tabacum GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_SPIOL (Photosystem II reaction center protein I OS=Spinacia oleracea GN=psbI PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_SOYBN (Photosystem II reaction center protein I OS=Glycine max GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_SORBI (Photosystem II reaction center protein I OS=Sorghum bicolor GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_SOLTU (Photosystem II reaction center protein I OS=Solanum tuberosum GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_SOLLC (Photosystem II reaction center protein I OS=Solanum lycopersicum GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_SOLBU (Photosystem II reaction center protein I OS=Solanum bulbocastanum GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
BLAST of DN134859 vs. ExPASy Swiss-Prot
Match: PSBI_SINAL (Photosystem II reaction center protein I OS=Sinapis alba GN=psbI PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.245e-14
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = 2
Query:   50 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 157
            MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE
Sbjct:    1 MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE 36          
The following BLAST results are available for this feature:
BLAST of DN134859 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
PSBI_WHEAT7.245e-14100.00Photosystem II reaction center protein I OS=Tritic... [more]
PSBI_VITVI7.245e-14100.00Photosystem II reaction center protein I OS=Vitis ... [more]
PSBI_TOBAC7.245e-14100.00Photosystem II reaction center protein I OS=Nicoti... [more]
PSBI_SPIOL7.245e-14100.00Photosystem II reaction center protein I OS=Spinac... [more]
PSBI_SOYBN7.245e-14100.00Photosystem II reaction center protein I OS=Glycin... [more]
PSBI_SORBI7.245e-14100.00Photosystem II reaction center protein I OS=Sorghu... [more]
PSBI_SOLTU7.245e-14100.00Photosystem II reaction center protein I OS=Solanu... [more]
PSBI_SOLLC7.245e-14100.00Photosystem II reaction center protein I OS=Solanu... [more]
PSBI_SOLBU7.245e-14100.00Photosystem II reaction center protein I OS=Solanu... [more]
PSBI_SINAL7.245e-14100.00Photosystem II reaction center protein I OS=Sinapi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca02d06 Developing fruit albedo at 80 DAFB in Vulnus5 vector Citrus sinensis cDNA clone wca02d06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN134859 ID=DN134859|Name=DN134859|organism=Citrus sinensis|type=EST|length=413bp
ATCTATTCTCTTTTTCCTTTCCCCAAAAACCTGATTTGGAGATTGTGTAA
TGCTTACTCTCAAACTCTTTGTTTACACCGTAGTGATATTCTTTGTTTCG
CTCTTCATCTTCGGATTCCTGTCTAATGATCCAGGGCGTAATCCCGGACG
CGAAGAATAAAAAAGGAAGGAGTTGCTTACTTTATTCGTATAAACGTTCT
TAGGATTTTTTGATTCCCAGTTACTATTAAAAATAAAGTAAAAGTGTTCG
CTAAAGTTAAATTTGAAAAATACCAAGCCATCGCCCGAAACGGAAAGAGA
GGGATTCGAACCCTCGGTACGAAGAACTCGTACACCGGATTACCAATCCG
ACGCTTTAATCCACTCAGCCATCTCTCCTAATTGAAAAAAAAAAAAAAAA
AAAAAAAAAAAAA
back to top