DN134785

Overview
NameDN134785
Unique NameDN134785
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length532
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2568 contig Csv1_Contig2568:133..664. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN134785 vs. ExPASy Swiss-Prot
Match: LEA5_CITSI (Late embryogenesis abundant protein Lea5 OS=Citrus sinensis GN=LEA5 PE=2 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 7.567e-49
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 3
Query:  156 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 446
            MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH
Sbjct:    1 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLGTISRTGIMEKNDLRPAVREDSGASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRAH 97          
BLAST of DN134785 vs. ExPASy Swiss-Prot
Match: LEA5D_GOSHI (Late embryogenesis abundant protein Lea5-D OS=Gossypium hirsutum GN=LEA5-D PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.217e-22
Identity = 58/104 (55.77%), Postives = 71/104 (68.27%), Query Frame = 3
Query:  156 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 443
            MARS+   KLL A + DG+ +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID AELREMLLNH+VR+
Sbjct:    1 MARSVSSFKLLGASIFDGLYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRDAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAAELREMLLNHRVRS 104          
BLAST of DN134785 vs. ExPASy Swiss-Prot
Match: LEA5A_GOSHI (Late embryogenesis abundant protein Lea5-A OS=Gossypium hirsutum GN=LEA5-A PE=2 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 8.718e-21
Identity = 55/104 (52.88%), Postives = 69/104 (66.35%), Query Frame = 3
Query:  156 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG---TISRTGIMEKNDLRPAVREDSGA-----SSAWAPDPITGYYRPENRAVEIDPAELREMLLNHKVRA 443
            MARS+   K L A V D + +SISRRGY+ A P     +  R G M K + R A++E S +     SSAWAPDP+TGYYRPEN   EID A+LREM+LNH+VR+
Sbjct:    1 MARSVSSFKFLGASVFDALYVSISRRGYSGAPPAAVTASFGRPGAMGKVERRYAMKESSSSETRAYSSAWAPDPVTGYYRPENCGAEIDAADLREMMLNHRVRS 104          
BLAST of DN134785 vs. ExPASy Swiss-Prot
Match: ARG2_PHAAU (Indole-3-acetic acid-induced protein ARG2 OS=Phaseolus aureus GN=ARG2 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.795e-11
Identity = 42/97 (43.30%), Postives = 56/97 (57.73%), Query Frame = 3
Query:  156 MARSLFKAKLLLAPVADGISLSISRRGYAAAAPLG-TISRTGIMEKNDLRPAVREDS---GASSAWAPDPITGYYRPENRAVEIDPAELREMLLNHK 434
            MARS    K+L A VADG S + +R G+AAAA    + +R G     ++ P   E+    G   +W PDP+TGYYRPEN   EID A++R  +L  K
Sbjct:    1 MARSFTNVKVLSALVADGFSNTTTRHGFAAAAAATQSATRGGASIGGNMVPKSGEEKVRGGEKVSWVPDPVTGYYRPEN-TNEIDVADMRATVLGKK 96          
The following BLAST results are available for this feature:
BLAST of DN134785 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
LEA5_CITSI7.567e-49100.00Late embryogenesis abundant protein Lea5 OS=Citrus... [more]
LEA5D_GOSHI1.217e-2255.77Late embryogenesis abundant protein Lea5-D OS=Goss... [more]
LEA5A_GOSHI8.718e-2152.88Late embryogenesis abundant protein Lea5-A OS=Goss... [more]
ARG2_PHAAU4.795e-1143.30Indole-3-acetic acid-induced protein ARG2 OS=Phase... [more]
back to top
Properties
Property NameValue
Genbank descriptionwca01c04 Developing fruit albedo at 80 DAFB in Vulnus5 vector Citrus sinensis cDNA clone wca01c04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN134785 ID=DN134785|Name=DN134785|organism=Citrus sinensis|type=EST|length=532bp
CCGGGGCTCAAAGCACAGCACAAAGAGAGCGAGCCGCTAGCTTTTGCCTA
TAGCTACTGCAGGAGCAGAATCTTTCTTCTTCTGTAGTAGCACTGTACAG
AAACATCCCAGCTAGCTATCTTCATATCTATTAAGTTCTATAAGTAAATA
AAACAATGGCCCGCTCTCTCTTCAAAGCTAAGCTTCTTCTTGCTCCTGTT
GCTGATGGCATCTCGCTCTCCATTAGCAGGAGAGGATATGCTGCAGCAGC
ACCCTTGGGGACCATATCTCGGACTGGTATCATGGAGAAAAATGATTTGA
GGCCTGCGGTGAGAGAGGATTCTGGGGCCTCTTCTGCCTGGGCCCCAGAT
CCCATCACTGGGTACTACAGGCCGGAGAATCGGGCGGTCGAGATTGATCC
AGCAGAGCTTCGAGAGATGCTGTTGAACCACAAAGTCAGGGCACACNNGG
GAGTGGTGGCGCATAGCAGCAGATCCTTTGCTGTTAGCGGTGCTTTAACT
TTTTAAGTGATGTNNNTACAGTAGCAATTTTG
back to top