DN134772

Overview
NameDN134772
Unique NameDN134772
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length497
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DN134772_ssr12 microsatellite DN134772_ssr12:12..29. BLAST: Citrus ESTs to Prunus persica proteins V1
DN134772_ssr158 microsatellite DN134772_ssr158:158..167. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig5666 contig Csv1_Contig5666:1..497. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: R13A4_ARATH (60S ribosomal protein L13a-4 OS=Arabidopsis thaliana GN=RPL13AD PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 8.716e-54
Identity = 101/106 (95.28%), Postives = 104/106 (98.11%), Query Frame = 2
Query:  179 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            MVSGSGIC+KRVVVDARHHMLGRLASI AKELLNGQKVV VRCEEIC+SGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAP+KIFWRTVRGMIPHKTKRGAAALAR
Sbjct:    1 MVSGSGICSKRVVVDARHHMLGRLASITAKELLNGQKVVIVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALAR 106          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: R13A2_ARATH (60S ribosomal protein L13a-2 OS=Arabidopsis thaliana GN=RPL13AB PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 4.326e-53
Identity = 99/106 (93.40%), Postives = 103/106 (97.17%), Query Frame = 2
Query:  179 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            MVSGSGIC+KRVVVDARHHM GRLASI+AKELLNGQ VV VRCEEIC+SGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAP+KIFWRTVRGMIPHKTKRGAAALAR
Sbjct:    1 MVSGSGICSKRVVVDARHHMCGRLASIIAKELLNGQSVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALAR 106          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: R13A1_ARATH (60S ribosomal protein L13a-1 OS=Arabidopsis thaliana GN=RPL13AA PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 7.379e-53
Identity = 98/106 (92.45%), Postives = 103/106 (97.17%), Query Frame = 2
Query:  179 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            MVSGSGICAKRVVVDARHHMLGRLAS+VAK+LLNGQ +V VRCEEIC+SGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAP+KIFWRTVRGMIPHKTKRGA ALAR
Sbjct:    1 MVSGSGICAKRVVVDARHHMLGRLASVVAKDLLNGQNIVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGANALAR 106          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: R13A3_ARATH (60S ribosomal protein L13a-3 OS=Arabidopsis thaliana GN=RPL13AC PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.644e-52
Identity = 99/106 (93.40%), Postives = 102/106 (96.23%), Query Frame = 2
Query:  179 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            MVSGSGICAKRVVVD RHHMLGRLAS  AKELLNGQ+VV VRCEEIC+SGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAP+KIFWRTVRGMIPHKTKRGAAALAR
Sbjct:    1 MVSGSGICAKRVVVDGRHHMLGRLASNTAKELLNGQEVVVVRCEEICLSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPSKIFWRTVRGMIPHKTKRGAAALAR 106          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: RL13A_PICMA (60S ribosomal protein L13a OS=Picea mariana GN=RPL13A PE=2 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 4.049e-51
Identity = 95/105 (90.48%), Postives = 102/105 (97.14%), Query Frame = 2
Query:  179 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALA 493
            MVSGSGICAK VVVDARHHMLGRLASI+AKELL+GQ+VV VRCEEICMSGGLVRQKMKY+RFLRKRMNTKPSHGPIHFRAP++I WRT+RGMIPHKTKRGAAALA
Sbjct:    1 MVSGSGICAKEVVVDARHHMLGRLASILAKELLHGQRVVVVRCEEICMSGGLVRQKMKYLRFLRKRMNTKPSHGPIHFRAPSRILWRTIRGMIPHKTKRGAAALA 105          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: RL13A_LUPLU (60S ribosomal protein L13a OS=Lupinus luteus GN=RPL13A PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 9.334e-48
Identity = 96/106 (90.57%), Postives = 99/106 (93.40%), Query Frame = 2
Query:  179 MVSGSGICAKRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            MVSGSGI AKRVVVDARHHMLGRLASIVAKELLNGQKVV VR EEIC+SGGLVRQKMKY+RFLRKRMNTKPSHGPIH  AP+KIFWRTVRGMIPHKTKRG  ALAR
Sbjct:    1 MVSGSGIAAKRVVVDARHHMLGRLASIVAKELLNGQKVVIVRSEEICISGGLVRQKMKYLRFLRKRMNTKPSHGPIHC-APSKIFWRTVRGMIPHKTKRGEHALAR 105          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: RL13A_RAT (60S ribosomal protein L13a OS=Rattus norvegicus GN=Rpl13a PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 2.915e-33
Identity = 66/95 (69.47%), Postives = 79/95 (83.16%), Query Frame = 2
Query:  212 VVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            +V+D R H+LGRLA+IVAK++L G+KVV VRCE I +SG   R K+KY+ FLRKRMNT PS GP HFRAP++IFWRTVRGM+PHKTKRG AAL R
Sbjct:    7 LVLDGRSHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALER 101          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: RL13A_MOUSE (60S ribosomal protein L13a OS=Mus musculus GN=Rpl13a PE=1 SV=4)

HSP 1 Score: 140.584 bits (353), Expect = 3.807e-33
Identity = 66/95 (69.47%), Postives = 79/95 (83.16%), Query Frame = 2
Query:  212 VVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            +V+D R H+LGRLA+IVAK++L G+KVV VRCE I +SG   R K+KY+ FLRKRMNT PS GP HFRAP++IFWRTVRGM+PHKTKRG AAL R
Sbjct:    7 LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALER 101          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: RL13A_CYAPA (60S ribosomal protein L13a OS=Cyanophora paradoxa PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.807e-33
Identity = 68/97 (70.10%), Postives = 79/97 (81.44%), Query Frame = 2
Query:  206 KRVVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            K VVVD R H+LGRLA+ +AKELLNGQ+VVAVR EEI +SG L R K+K+  FL+KRMNT P  GP HFR+PA+I WRT+RGMIPHKT RGAAAL R
Sbjct:    4 KVVVVDCRGHLLGRLAATLAKELLNGQRVVAVRTEEINISGSLFRNKLKFHAFLKKRMNTNPRRGPFHFRSPARILWRTIRGMIPHKTPRGAAALER 100          
BLAST of DN134772 vs. ExPASy Swiss-Prot
Match: RL13A_BOVIN (60S ribosomal protein L13a OS=Bos taurus GN=RPL13A PE=2 SV=3)

HSP 1 Score: 140.584 bits (353), Expect = 3.807e-33
Identity = 66/95 (69.47%), Postives = 79/95 (83.16%), Query Frame = 2
Query:  212 VVVDARHHMLGRLASIVAKELLNGQKVVAVRCEEICMSGGLVRQKMKYMRFLRKRMNTKPSHGPIHFRAPAKIFWRTVRGMIPHKTKRGAAALAR 496
            +V+D R H+LGRLA+IVAK++L G+KVV VRCE I +SG   R K+KY+ FLRKRMNT PS GP HFRAP++IFWRTVRGM+PHKTKRG AAL R
Sbjct:    7 LVLDGRGHLLGRLAAIVAKQVLLGRKVVVVRCEGINISGNFYRNKLKYLAFLRKRMNTNPSRGPYHFRAPSRIFWRTVRGMLPHKTKRGQAALER 101          
The following BLAST results are available for this feature:
BLAST of DN134772 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 31
Match NameE-valueIdentityDescription
R13A4_ARATH8.716e-5495.2860S ribosomal protein L13a-4 OS=Arabidopsis thalia... [more]
R13A2_ARATH4.326e-5393.4060S ribosomal protein L13a-2 OS=Arabidopsis thalia... [more]
R13A1_ARATH7.379e-5392.4560S ribosomal protein L13a-1 OS=Arabidopsis thalia... [more]
R13A3_ARATH1.644e-5293.4060S ribosomal protein L13a-3 OS=Arabidopsis thalia... [more]
RL13A_PICMA4.049e-5190.4860S ribosomal protein L13a OS=Picea mariana GN=RPL... [more]
RL13A_LUPLU9.334e-4890.5760S ribosomal protein L13a OS=Lupinus luteus GN=RP... [more]
RL13A_RAT2.915e-3369.4760S ribosomal protein L13a OS=Rattus norvegicus GN... [more]
RL13A_MOUSE3.807e-3369.4760S ribosomal protein L13a OS=Mus musculus GN=Rpl1... [more]
RL13A_CYAPA3.807e-3370.1060S ribosomal protein L13a OS=Cyanophora paradoxa ... [more]
RL13A_BOVIN3.807e-3369.4760S ribosomal protein L13a OS=Bos taurus GN=RPL13A... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca01b03 Developing fruit albedo at 80 DAFB in Vulnus5 vector Citrus sinensis cDNA clone wca01b03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN134772 ID=DN134772|Name=DN134772|organism=Citrus sinensis|type=EST|length=497bp
TACGGCCGGGGGAGAGAGAGAGAGAGAGAGCGTTCATGCAACCCTAGAAA
CCCTAGCTCCACATTNNNGCCTCACATATATATTTGACAACACTCGGAAA
CCTCCAGTTCGAGAGAGGGAGAGAGAGCAGAAGAGGGAGAGAAAAAGCCA
ACAAAATAGAGAGAGAGGAACCCTAATAATGGTGTCGGGATCGGGAATCT
GCGCGAAGCGAGTGGTGGTGGACGCACGCCACCACATGCTGGGGCGGCTG
GCGTCGATCGTGGCCAAGGAGCTCCTCAACGGACAGAAAGTCGTCGCGGT
CCGCTGCGAAGAGATTTGCATGTCCGGCGGCCTCGTCCGCCAGAAAATGA
AGTACATGCGGTTCCTTCGCAAGCGCATGAACACCAAGCCTTCTCACGGT
CCCATCCACTTCCGCGCCCCTGCCAAGATCTTCTGGCGCACCGTCCGCGG
GATGATACCGCATAAGACCAAGCGTGGAGCTGCAGCACTTGCTCGAT
back to top