DN134763

Overview
NameDN134763
Unique NameDN134763
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length667
Libraries
Library NameType
Developing fruit albedo at 80 DAFB in Vulnus5 vectorcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8093 contig Csv1_Contig8093:961..1628. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: TDT_ARATH (Tonoplast dicarboxylate transporter OS=Arabidopsis thaliana GN=TDT PE=2 SV=2)

HSP 1 Score: 319.316 bits (817), Expect = 1.120e-86
Identity = 161/214 (75.23%), Postives = 177/214 (82.71%), Query Frame = 2
Query:   26 MAFAEXXVLAVFGMLIALWMTRSITDDIPGWGALFNDRAGDGTASVVMATLLFIIPSMKQKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDXXXXXXXXXXXXIAALAFLMPT 667
            M FAE  VLAVFG L+ LWMTR+ITDDIPGWG +F  RAGDGT SV+MATLLFIIPS  +KGEKLMDWNKCKKLPWNI+LLLGAGFAIADGVRTSGLA+ LSK L FLE APY AIAP VCLI+A ITEF SNNATTTL++PLLI+IAK M +HPLLLMVPGAIGAQF+FLLPTGTPSN+VGFTTGHIEI+D               L+ LMPT
Sbjct:  315 MNFAEKMVLAVFGGLVVLWMTRNITDDIPGWGRIFAGRAGDGTVSVMMATLLFIIPSNIKKGEKLMDWNKCKKLPWNIVLLLGAGFAIADGVRTSGLAEVLSKGLVFLETAPYWAIAPTVCLIAATITEFTSNNATTTLLVPLLIEIAKNMGIHPLLLMVPGAIGAQFAFLLPTGTPSNVVGFTTGHIEIKDMIKTGLPLKIAGTIFLSILMPT 528          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: SDCS_STAS1 (Sodium-dependent dicarboxylate transporter sdcS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sdcS PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.834e-35
Identity = 75/192 (39.06%), Postives = 115/192 (59.90%), Query Frame = 2
Query:   26 MAFAEXXVLAVFGMLIALWMTRSITDDIPGWGALFNDRAGDGTASVVMATLLFIIPSM-KQKGEKLMDWNKCKKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQ 598
            M + E  VL VF +   LW+TR     +  W   F     DGT ++ ++ LLF+IP+  K+K ++++DW   K LPW +++L G G A+A G+  SGLA+ L + L  +E    L I  ++ +    +TE  SN AT T++LP+L  ++  ++VHPLLLMVP A+ A  +++LP GTP N + F TG I I+
Sbjct:  292 MKYEEKVVLIVFLLASFLWITREFL--LKHW--TFTSEVADGTIAMFISVLLFLIPAKNKEKHKRIIDWEVAKDLPWGVLILFGGGLALAKGISESGLANWLGEQLKLIEGVSPLVIVLVITIFVLFLTEITSNTATATMILPILATLSVAVNVHPLLLMVPAAMAANCAYMLPVGTPPNAIVFGTGKISIK 479          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A3_MOUSE (Solute carrier family 13 member 3 OS=Mus musculus GN=Slc13a3 PE=2 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 6.450e-34
Identity = 83/227 (36.56%), Postives = 117/227 (51.54%), Query Frame = 2
Query:   32 FAEXXVLAVFGMLIALWMTRSITDDIPGWGALFNDR-AGDGTASVVMATLLFIIPSMK-------------QKGEKLMDWNKCKK-LPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDXXXXXXXXXXXXIAALAFLMPT 667
            FAE  V  +F     L  +R     IPGW +LF      D    V + T+LF  PS K              + E L+ W K ++ +PWNIILLLG GFA+A G   SGL+  +   L  LE  P L    ++ ++ A  TEF SN AT  + LP+L ++A  +HVHPL LM+PG +G  ++F+LP  TP N + F+TGH+ ++D            +  L+  M T
Sbjct:  338 FAEQAVFILFCTFAILLFSRD-PKFIPGWASLFAPGFVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQLHPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLHVHPLYLMIPGTVGCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTGLLMNLMGVLLLSLAMNT 563          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A3_RAT (Solute carrier family 13 member 3 OS=Rattus norvegicus GN=Slc13a3 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 1.437e-33
Identity = 82/227 (36.12%), Postives = 117/227 (51.54%), Query Frame = 2
Query:   32 FAEXXVLAVFGMLIALWMTRSITDDIPGWGALFNDR-AGDGTASVVMATLLFIIPSMK-------------QKGEKLMDWNKCKK-LPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDXXXXXXXXXXXXIAALAFLMPT 667
            FAE  V  +F +   L  +R     IPGW +LF      D    V + T+LF  PS K              + E L+ W K ++ +PWNIILLLG GFA+A G   SGL+  +   L  LE  P L    ++ ++ A  TEF SN AT  + LP+L ++A  +HVHPL LM+PG +   ++F+LP  TP N + F+TGH+ ++D            +  L+  M T
Sbjct:  338 FAEQAVFILFCLFAILLFSRD-PKFIPGWASLFAPGFVSDAVTGVAIVTILFFFPSQKPSLKWWFDFKAPNSETEPLLSWKKAQETVPWNIILLLGGGFAMAKGCEESGLSAWIGGQLHPLEHVPPLLAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLHVHPLYLMIPGTVSCSYAFMLPVSTPPNSIAFSTGHLLVKDMVRTGLLMNLMGVLLLSLAMNT 563          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A5_HUMAN (Solute carrier family 13 member 5 OS=Homo sapiens GN=SLC13A5 PE=1 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.877e-33
Identity = 81/214 (37.85%), Postives = 121/214 (56.54%), Query Frame = 2
Query:   26 MAFAEXXVLAVFGMLIALWMTRSITDDIPGWGALF-----NDRAGDGTASVVMATLLFIIPSMKQKGE----------------KLMDWNKCK-KLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQD 601
            ++FAE  VL  F +L+ LW +R     +PGW  +           D T ++ +ATLLFI+PS K K                   L+DW   + K+PW I+LLLG GFA+A G   SGL+  + K ++ L A P  AI  I+ L+ A+ TE  SN ATTTL LP+   +++++ ++PL +M+P  + A F+F+LP  TP N + FT GH+++ D
Sbjct:  312 LSFAEINVLICFFLLVILWFSRD-PGFMPGWLTVAWVEGETKYVSDATVAIFVATLLFIVPSQKPKFNFRSQTEEERKTPFYPPPLLDWKVTQEKVPWGIVLLLGGGFALAKGSEASGLSVWMGKQMEPLHAVPPAAITLILSLLVAVFTECTSNVATTTLFLPIFASMSRSIGLNPLYIMLPCTLSASFAFMLPVATPPNAIVFTYGHLKVAD 524          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A3_HUMAN (Solute carrier family 13 member 3 OS=Homo sapiens GN=SLC13A3 PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.877e-33
Identity = 83/227 (36.56%), Postives = 116/227 (51.10%), Query Frame = 2
Query:   32 FAEXXVLAVFGMLIALWMTRSITDDIPGWGALFNDR-AGDGTASVVMATLLFIIPSMKQ-------------KGEKLMDWNKCKK-LPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQDXXXXXXXXXXXXIAALAFLMPT 667
            FAE  V  +F M   L  TR     IPGW +LFN     D    V + T+LF  PS +              + E L+ W K ++ +PWNIILLLG GFA+A G   SGL+  +   L  LE  P      ++ ++ A  TEF SN AT  + LP+L ++A  + VHPL LM+PG +G  F+F+LP  TP N + F +GH+ ++D            +  L+  M T
Sbjct:  340 FAEQAVFILFCMFAILLFTRD-PKFIPGWASLFNPGFLSDAVTGVAIVTILFFFPSQRPSLKWWFDFKAPNTETEPLLTWKKAQETVPWNIILLLGGGFAMAKGCEESGLSVWIGGQLHPLENVPPALAVLLITVVIAFFTEFASNTATIIIFLPVLAELAIRLRVHPLYLMIPGTVGCSFAFMLPVSTPPNSIAFASGHLLVKDMVRTGLLMNLMGVLLLSLAMNT 565          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A2_RABIT (Solute carrier family 13 member 2 OS=Oryctolagus cuniculus GN=SLC13A2 PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.539e-32
Identity = 82/212 (38.68%), Postives = 122/212 (57.55%), Query Frame = 2
Query:   26 MAFAEXXVLAVFGMLIALWMTRSITDDIPGWGAL-FNDRAG-----DGTASVVMATLLFIIPS----MKQKGEK---------LMDWNKC-KKLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQD 601
            M+FAE  V  +F +L+ LW TR       GWG L F+D +G     DG+AS+++   LF++PS    + Q  +          L++W    KK+PWNI+LLLG G+A+A G   SGL+  L   L  L+  P  A   I+CL+ A  TE  SN ATTTL+LP+L  +A+ + +HPL +M+P  + +  +F+LP  TP N + F+ G + + D
Sbjct:  328 MSFAEKAVFILFVILVLLWFTRE-PGFFHGWGNLVFSDASGRVMVSDGSASILIGVFLFMVPSKIPGLTQDPDNPGRLKAPPALLNWKLVNKKMPWNIVLLLGGGYALAKGSEESGLSQWLGNKLMPLQHVPPPATVFIICLLVATFTECTSNAATTTLLLPILASMAQAICLHPLYVMLPCTLASSLAFMLPVATPPNAIVFSFGGLRVSD 538          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A2_RAT (Solute carrier family 13 member 2 OS=Rattus norvegicus GN=Slc13a2 PE=2 SV=2)

HSP 1 Score: 136.346 bits (342), Expect = 1.345e-31
Identity = 83/213 (38.97%), Postives = 122/213 (57.28%), Query Frame = 2
Query:   26 MAFAEXXVLAV-FGMLIALWMTRSITDDIPGWG-ALFNDRAG-----DGTASVVMATLLFIIPSM--------KQKGE-----KLMDWNKCK-KLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQD 601
            M+FAE     V F +L+ LW TR      PGWG  +F +  G     DGT ++ ++ ++FIIPS         K+ G+      ++ W     K+PWNI++LLG GFA+A G   SGL++ L   L  L+  P  A A I+CL+ AI TE  SN ATTTL LP+L  +A+ + +HPL +M+P  + A  +F+LP  TP N + F+ G +++ D
Sbjct:  319 MSFAEKTCSTVLFVLLVVLWFTRE-PGFFPGWGDTVFANEKGQSMPSDGTVAIFISLVMFIIPSKIPGLMEDPKKPGKLKAPPAILTWKTVNDKMPWNIVILLGGGFALAKGSEQSGLSEWLGDKLTPLQHIPPSATAVILCLLIAIFTECTSNVATTTLFLPILASMAQAICLHPLYVMLPCTLAASLAFMLPVATPPNAIVFSFGGLKVSD 530          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A5_RAT (Solute carrier family 13 member 5 OS=Rattus norvegicus GN=Slc13a5 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.294e-31
Identity = 77/214 (35.98%), Postives = 120/214 (56.07%), Query Frame = 2
Query:   26 MAFAEXXVLAVFGMLIALWMTRSITDDIPGWGALF-----NDRAGDGTASVVMATLLFIIPSMKQKGE----------------KLMDWNKCK-KLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQD 601
            +++AE  VL  FG+LI LW +R     +PGW ++           D T ++ +A LLFI+PS K K                   L++W   + K+PW I+LLLG GFA+A G  TSGL++ +++ ++ L +     I  I+  I A+ TE  SN ATTTL LP+   +A+++ +HPL +M+P  + A  +F+LP  TP N + F  GH+++ D
Sbjct:  316 LSYAECNVLFCFGLLIILWFSRD-PGFMPGWLSIAWIEGNTKHVTDATVAIFVAILLFIVPSQKPKFNFSRQTEEERKTPFYPPPLLNWKVTQEKVPWGIVLLLGGGFAMAKGCETSGLSEWMARQMEPLSSVRPAIITLILSCIVAMTTECTSNVATTTLFLPIFASMARSIGIHPLYVMIPCTLSASLAFMLPVATPPNAIVFAYGHLKVID 528          
BLAST of DN134763 vs. ExPASy Swiss-Prot
Match: S13A2_MOUSE (Solute carrier family 13 member 2 OS=Mus musculus GN=Slc13a2 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.913e-31
Identity = 81/212 (38.21%), Postives = 120/212 (56.60%), Query Frame = 2
Query:   26 MAFAEXXVLAVFGMLIALWMTRSITDDIPGWG-ALFNDRAG-----DGTASVVMATLLFIIPSM--------KQKGE-----KLMDWNKCK-KLPWNIILLLGAGFAIADGVRTSGLADDLSKALDFLEAAPYLAIAPIVCLISAIITEFISNNATTTLVLPLLIQIAKTMHVHPLLLMVPGAIGAQFSFLLPTGTPSNIVGFTTGHIEIQD 601
            M+FAE  V  +F +L+ LW TR      PGWG   F ++ G     DGT ++ ++ ++FIIPS         K+ G+      ++ W     K+PWNI++LLG GFA+A G   SGL+  L   L  L+  P  A   I+ L+ AI TE  SN ATTTL LP+L  +A+ + +HPL +M+P  + A  +F+LP  TP N + F+ G +++ D
Sbjct:  320 MSFAEKAVTFLFVLLVVLWFTRE-PGFFPGWGDTAFANKKGQSMVSDGTVAIFISLIMFIIPSKIPGLTEDPKKPGKLKAPPAILTWKTVNDKMPWNILILLGGGFALAKGSEESGLSKWLGDKLTPLQHVPPSATVLILSLLVAIFTECTSNVATTTLFLPILASMAQAICLHPLYVMLPCTLAASLAFMLPVATPPNAIVFSFGGLKVSD 530          
The following BLAST results are available for this feature:
BLAST of DN134763 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
TDT_ARATH1.120e-8675.23Tonoplast dicarboxylate transporter OS=Arabidopsis... [more]
SDCS_STAS15.834e-3539.06Sodium-dependent dicarboxylate transporter sdcS OS... [more]
S13A3_MOUSE6.450e-3436.56Solute carrier family 13 member 3 OS=Mus musculus ... [more]
S13A3_RAT1.437e-3336.12Solute carrier family 13 member 3 OS=Rattus norveg... [more]
S13A5_HUMAN1.877e-3337.85Solute carrier family 13 member 5 OS=Homo sapiens ... [more]
S13A3_HUMAN1.877e-3336.56Solute carrier family 13 member 3 OS=Homo sapiens ... [more]
S13A2_RABIT3.539e-3238.68Solute carrier family 13 member 2 OS=Oryctolagus c... [more]
S13A2_RAT1.345e-3138.97Solute carrier family 13 member 2 OS=Rattus norveg... [more]
S13A5_RAT2.294e-3135.98Solute carrier family 13 member 5 OS=Rattus norveg... [more]
S13A2_MOUSE3.913e-3138.21Solute carrier family 13 member 2 OS=Mus musculus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionwca01a02 Developing fruit albedo at 80 DAFB in Vulnus5 vector Citrus sinensis cDNA clone wca01a02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN134763 ID=DN134763|Name=DN134763|organism=Citrus sinensis|type=EST|length=667bp
AGAGAGAGCTTGACATGTTAGGTCCATGGCTTTTGCTGAAANNNTGGTAC
TAGCTGTATTTGGGATGCTAATAGCATTGTGGATGACAAGATCAATAACA
GATGACATTCCAGGTTGGGGAGCACTCTTCAATGACCGTGCTGGTGATGG
AACTGCTAGTGTTGTGATGGCAACATTGTTGTTCATAATTCCAAGCATGA
AGCAAAAGGGAGAAAAATTGATGGATTGGAACAAATGCAAAAAGCTACCT
TGGAACATTATATTGCTTTTAGGGGCTGGCTTTGCTATAGCTGATGGAGT
CAGGACTAGCGGTCTTGCTGATGATCTGTCAAAAGCATTGGATTTCCTGG
AGGCGGCGCCATATTTAGCCATTGCACCTATCGTATGTCTGATTAGCGCG
ATTATTACTGAATTCATATCAAATAATGCCACAACAACTCTCGTTCTTCC
ACTTCTGATCCAAATAGCAAAAACTATGCATGTTCATCCATTGCTTCTTA
TGGTTCCTGGAGCAATTGGAGCACAATTTTCTTTCTTGTTGCCGACTGGA
ACCCCTTCAAATATCGTTGGATTCACAACCGGGCACATCGAAATTCAAGA
TANNNNNNNGANNGGGCTGCCCCTTCCNNNNGNTGGCATTGCTGCTCTGG
CCTTTCTAATGCCTACA
back to top