DC900437

Overview
NameDC900437
Unique NameDC900437
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length193
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900437 vs. ExPASy Swiss-Prot
Match: SCP20_ARATH (Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana GN=SCPL20 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 3.289e-14
Identity = 35/59 (59.32%), Postives = 45/59 (76.27%), Query Frame = 2
Query:   20 MYKILACYTLLSFS-VLTHSAPETALIAQIPGFXGNLPSKHYSGYVTVDESHGRNLFYY 193
            + K+    TLLS   V+T SAPE+ALI ++PGF G  PSKHYSGYVT+D+ HG+NL+YY
Sbjct:    9 LMKVFVFVTLLSLVFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKEHGKNLWYY 67          
BLAST of DC900437 vs. ExPASy Swiss-Prot
Match: CBP1_ORYSJ (Serine carboxypeptidase 1 OS=Oryza sativa subsp. japonica GN=CBP1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.404e-11
Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 2
Query:   74 SAPETALIAQIPGFXGNLPSKHYSGYVTVDESHGRNLFYY 193
            +AP +A++  +PGF G LPSKHY+GYVTV+E HGRNLFYY
Sbjct:   36 AAPASAVVKSVPGFDGALPSKHYAGYVTVEEQHGRNLFYY 75          
BLAST of DC900437 vs. ExPASy Swiss-Prot
Match: CBP1_HORVU (Serine carboxypeptidase 1 OS=Hordeum vulgare GN=CBP1 PE=1 SV=4)

HSP 1 Score: 66.2402 bits (160), Expect = 5.806e-11
Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 2
Query:   74 SAPETALIAQIPGFXGNLPSKHYSGYVTVDESHGRNLFYY 193
            +AP+ A +  +PGF G LPSKHY+GYVTVDE HGRNLFYY
Sbjct:   30 AAPQGAEVTGLPGFDGALPSKHYAGYVTVDEGHGRNLFYY 69          
The following BLAST results are available for this feature:
BLAST of DC900437 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SCP20_ARATH3.289e-1459.32Serine carboxypeptidase-like 20 OS=Arabidopsis tha... [more]
CBP1_ORYSJ3.404e-1167.50Serine carboxypeptidase 1 OS=Oryza sativa subsp. j... [more]
CBP1_HORVU5.806e-1170.00Serine carboxypeptidase 1 OS=Hordeum vulgare GN=CB... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900437 VSS Citrus sinensis cDNA clone VSSG034 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900437 ID=DC900437|Name=DC900437|organism=Citrus sinensis|type=EST|length=193bp
GGCACGAGGTCGTCTTATCATGTACAAGATACTAGCTTGTTACACATTAT
TGAGCTTTTCAGTGTTGACTCATTCAGCTCCTGAAACTGCTCTCATCGCT
CAGATTCCTGGCTTCTNTGGCAATCTCCCTTCCAAGCACTATTCTGGGTA
TGTNACGGTTGATGAAAGCCATGGGAGGAACCTCTTTTACTAC
back to top