DC900437
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DC900437 vs. ExPASy Swiss-Prot
Match: SCP20_ARATH (Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana GN=SCPL20 PE=2 SV=2) HSP 1 Score: 77.0258 bits (188), Expect = 3.289e-14 Identity = 35/59 (59.32%), Postives = 45/59 (76.27%), Query Frame = 2 Query: 20 MYKILACYTLLSFS-VLTHSAPETALIAQIPGFXGNLPSKHYSGYVTVDESHGRNLFYY 193 + K+ TLLS V+T SAPE+ALI ++PGF G PSKHYSGYVT+D+ HG+NL+YY Sbjct: 9 LMKVFVFVTLLSLVFVITESAPESALITKLPGFEGTFPSKHYSGYVTIDKEHGKNLWYY 67
BLAST of DC900437 vs. ExPASy Swiss-Prot
Match: CBP1_ORYSJ (Serine carboxypeptidase 1 OS=Oryza sativa subsp. japonica GN=CBP1 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.404e-11 Identity = 27/40 (67.50%), Postives = 34/40 (85.00%), Query Frame = 2 Query: 74 SAPETALIAQIPGFXGNLPSKHYSGYVTVDESHGRNLFYY 193 +AP +A++ +PGF G LPSKHY+GYVTV+E HGRNLFYY Sbjct: 36 AAPASAVVKSVPGFDGALPSKHYAGYVTVEEQHGRNLFYY 75
BLAST of DC900437 vs. ExPASy Swiss-Prot
Match: CBP1_HORVU (Serine carboxypeptidase 1 OS=Hordeum vulgare GN=CBP1 PE=1 SV=4) HSP 1 Score: 66.2402 bits (160), Expect = 5.806e-11 Identity = 28/40 (70.00%), Postives = 33/40 (82.50%), Query Frame = 2 Query: 74 SAPETALIAQIPGFXGNLPSKHYSGYVTVDESHGRNLFYY 193 +AP+ A + +PGF G LPSKHY+GYVTVDE HGRNLFYY Sbjct: 30 AAPQGAEVTGLPGFDGALPSKHYAGYVTVDEGHGRNLFYY 69 The following BLAST results are available for this feature:
BLAST of DC900437 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DC900437 ID=DC900437; Name=DC900437; organism=Citrus sinensis; type=EST; length=193bpback to top |