DC900430

Overview
NameDC900430
Unique NameDC900430
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length300
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9566 contig Csv1_Contig9566:66..365. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900430 vs. ExPASy Swiss-Prot
Match: GDL2_ARATH (GDSL esterase/lipase At1g09390 OS=Arabidopsis thaliana GN=At1g09390 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.981e-19
Identity = 44/56 (78.57%), Postives = 49/56 (87.50%), Query Frame = 3
Query:  114 VAAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTFFGRSTGRLSDGRLLID 281
            VA  C+ PPVIFNFGDSNSDTGGL AGLG+ + LPNGR+FF RSTGRLSDGRL+ID
Sbjct:   28 VAGGCQVPPVIFNFGDSNSDTGGLVAGLGYSIGLPNGRSFFQRSTGRLSDGRLVID 83          
BLAST of DC900430 vs. ExPASy Swiss-Prot
Match: LIP4_ARATH (GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana GN=LIP4 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.413e-19
Identity = 44/55 (80.00%), Postives = 46/55 (83.64%), Query Frame = 3
Query:  117 AAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTFFGRSTGRLSDGRLLID 281
            AA C   PVIFNFGDSNSDTGGL AGLG+P+  PNGR FF RSTGRLSDGRLLID
Sbjct:   32 AASCTARPVIFNFGDSNSDTGGLVAGLGYPIGFPNGRLFFRRSTGRLSDGRLLID 86          
BLAST of DC900430 vs. ExPASy Swiss-Prot
Match: GDL60_ARATH (GDSL esterase/lipase At3g62280 OS=Arabidopsis thaliana GN=At3g62280 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.273e-14
Identity = 33/58 (56.90%), Postives = 43/58 (74.14%), Query Frame = 3
Query:  108 SPVAAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTFFGRSTGRLSDGRLLID 281
            S  + +    P++ NFGDSNSDTGG+ AG+G P+ LP+G TFF R TGRL DGRL++D
Sbjct:   25 SETSYKSNKKPILINFGDSNSDTGGVLAGVGLPIGLPHGITFFHRGTGRLGDGRLIVD 82          
BLAST of DC900430 vs. ExPASy Swiss-Prot
Match: EST_HEVBR (Esterase OS=Hevea brasiliensis PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.375e-12
Identity = 37/67 (55.22%), Postives = 47/67 (70.15%), Query Frame = 3
Query:   93 VCFLASPVAAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTFFGRSTGRLSDGRLLIDSSAK 293
            +C L+   A++  + P IFNFGDSNSDTGG  A   +P++ P G TFF RSTGR SDGRL+ID  A+
Sbjct:   18 LCMLSLAYASETCDFPAIFNFGDSNSDTGGKAAAF-YPLNPPYGETFFHRSTGRYSDGRLIIDFIAE 83          
BLAST of DC900430 vs. ExPASy Swiss-Prot
Match: GDL54_ARATH (GDSL esterase/lipase At3g27950 OS=Arabidopsis thaliana GN=At3g27950 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.593e-11
Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = 3
Query:  108 SPVAAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTFFGRSTGRLSDGRLLID 281
            S +++ C N P +FNFGDSNSDTG + A +G  V  PNG  FFGRS GR SDGRL+ID
Sbjct:   22 SALSSSC-NFPAVFNFGDSNSDTGAISAAIG-EVPPPNGVAFFGRSAGRHSDGRLIID 77          
BLAST of DC900430 vs. ExPASy Swiss-Prot
Match: GDL53_ARATH (GDSL esterase/lipase At3g26430 OS=Arabidopsis thaliana GN=At3g26430 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.387e-11
Identity = 35/66 (53.03%), Postives = 41/66 (62.12%), Query Frame = 3
Query:   96 CFLASPVAAQCKNPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTFFGRSTGRLSDGRLLIDSSAK 293
            C +     +   N P IFNFGDSNSDTGGL A  G     PNG+TFF   +GR SDGRL+ID  A+
Sbjct:   16 CLIHPRACSPSCNFPAIFNFGDSNSDTGGLSASFG-QAPYPNGQTFFHSPSGRFSDGRLIIDFIAE 80          
BLAST of DC900430 vs. ExPASy Swiss-Prot
Match: GDL22_ARATH (GDSL esterase/lipase At1g54790 OS=Arabidopsis thaliana GN=At1g54790 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 7.544e-11
Identity = 32/50 (64.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query:  132 NPPVIFNFGDSNSDTGGLFAGLGFPVDLPNGRTFFGRSTGRLSDGRLLID 281
            N P  FNFGDSNSDTG L AGLG  +DLPNG+  F  S+ R  DGRL+ID
Sbjct:   28 NYPSAFNFGDSNSDTGDLVAGLGIRLDLPNGQNSFKTSSQRFCDGRLVID 77          
The following BLAST results are available for this feature:
BLAST of DC900430 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
GDL2_ARATH1.981e-1978.57GDSL esterase/lipase At1g09390 OS=Arabidopsis thal... [more]
LIP4_ARATH4.413e-1980.00GDSL esterase/lipase LIP-4 OS=Arabidopsis thaliana... [more]
GDL60_ARATH3.273e-1456.90GDSL esterase/lipase At3g62280 OS=Arabidopsis thal... [more]
EST_HEVBR1.375e-1255.22Esterase OS=Hevea brasiliensis PE=1 SV=1[more]
GDL54_ARATH2.593e-1160.34GDSL esterase/lipase At3g27950 OS=Arabidopsis thal... [more]
GDL53_ARATH3.387e-1153.03GDSL esterase/lipase At3g26430 OS=Arabidopsis thal... [more]
GDL22_ARATH7.544e-1164.00GDSL esterase/lipase At1g54790 OS=Arabidopsis thal... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900430 VSS Citrus sinensis cDNA clone VSSG017 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900430 ID=DC900430|Name=DC900430|organism=Citrus sinensis|type=EST|length=300bp
GGCACGAGCTCACTCTCATGGCTTCGCATCACCACCGCCTTCACTTTTCA
CAACTCCTCTTCATTTCTTCATTCTTATTTTTCGGCCTCTACGTTTGTTT
TCTTGCAAGCCCAGTTGCCGCTCAGTGCAAGAACCCGCCGGTGATCTTCA
ACTTCGGCGATTCCAACTCCGACACCGGCGGACTCTTTGCCGGACTCGGC
TTCCCCGTCGATCTTCCCAATGGCCGTACCTTTTTCGGTAGATCAACCGG
TCGTTTGTCCGATGGACGNCTCCTGATCGATTCCTCTGCCAAAGTTGAAT
back to top