DC900422

Overview
NameDC900422
Unique NameDC900422
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length518
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10933 contig Csv1_Contig10933:17..539. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900422 vs. ExPASy Swiss-Prot
Match: UCP7_SCHPO (UBA domain-containing protein 7 OS=Schizosaccharomyces pombe GN=ucp7 PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.550e-11
Identity = 35/99 (35.35%), Postives = 52/99 (52.53%), Query Frame = -3
Query:  214 RNRLAEALDADVKRWSRGKAGNLRALLSTXQNILGPDSGWQPIPLTXLIATAAVKTSYXRAPLVVHPDKLQQRGASYSRVHM*KVFDLPKEPWNRFNAE 510
            R+RL E +   V +W  GK  NLRALL++   IL P+  WQ + L+ L+    VK +Y +A   VHPDKL Q+ +   ++     F +    W  F  +
Sbjct:  596 RSRLREPVQQIVNKWKEGKESNLRALLASLDTILWPECRWQKVSLSELVLPKKVKIAYMKAVSRVHPDKLPQQTSVEHQLIAESAFSILNHAWELFKQQ 694          
The following BLAST results are available for this feature:
BLAST of DC900422 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
UCP7_SCHPO1.550e-1135.35UBA domain-containing protein 7 OS=Schizosaccharom... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900422 VSS Citrus sinensis cDNA clone VSSE015 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900422 ID=DC900422|Name=DC900422|organism=Citrus sinensis|type=EST|length=518bp
AGGAATTGTTAAAGCTTACTTCCGACTCGTAATCAGAATAAAGTTAAATA
CAAATAATGTCCTAAGAGTACAGAAAATGTTTTGTTACGTACAAGTGGGT
CTGAAAAGAATGGTTGGTGAAGCTTCGATTCCTACTTTNAGTTACAGGAT
ACGGTAATAAATTACGTACTTTACCTAAGAAAATGCTTTGCTGAGGAAAC
CTGTTTATGGTTCCTCTGCATTGAATCTGTTCCACGGTTCCTTTGGAAGA
TCAAAAACTTTTCACATGTGTACTCTGCTGTAACTTGCACCTCGCTGCTG
TAACTTGTCGGGGTGAACAACAAGTGGGGCCCTCNTGTANGATGTTTTTA
CAGCAGCAGTTGCTATAAGANCTGTTAGGGGAATTGGCTGCCAACCACTA
TCAGGCCCAAGGATATTTTGTANCGTTGAAAGCAGCGCACGCAAGTTTCC
AGCCTTCCCACGTGACCACCTTTTGACATCAGCATCTAGAGCTTCTGCTA
ATCTATTTCTCCTCGTGC
back to top