DC900413

Overview
NameDC900413
Unique NameDC900413
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length829
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6779 contig Csv1_Contig6779:362..1190. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: PNAE_RAUSE (Polyneuridine-aldehyde esterase OS=Rauvolfia serpentina GN=PNAE PE=1 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 4.451e-76
Identity = 136/256 (53.12%), Postives = 183/256 (71.48%), Query Frame = 3
Query:   24 EEKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDNLSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQIS 791
            ++KHFVLVHG   GAW WYKLK  L + GH+VTAVDL+A+GIN +R++++HTF  YSEPLMEV+AS+P +EKV+L+GHS GG++L LA + +P KISVAVF++A MPD  H  ++  E+Y+EK     D  LD+QFS         +SM+ G +F+ +K++Q C  EDLELAKML RPGS+F  +L+K  KFS E YGSVKR Y+ C ED   P +FQ W +++   ++V EIK  DHM MLS P+++C CL  IS
Sbjct:    9 QQKHFVLVHGGCLGAWIWYKLKPLLESAGHKVTAVDLSAAGINPRRLDEIHTFRDYSEPLMEVMASIPPDEKVVLLGHSFGGMSLGLAMETYPEKISVAVFMSAMMPDPNHSLTYPFEKYNEKC--PADMMLDSQFSTYGNPENPGMSMILGPQFMALKMFQNCSVEDLELAKMLTRPGSLFFQDLAKAKKFSTERYGSVKRAYIFCNEDKSFPVEFQKWFVESVGADKVKEIKEADHMGMLSQPREVCKCLLDIS 262          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: PIR7A_ORYSJ (Probable esterase PIR7A OS=Oryza sativa subsp. japonica GN=PIR7A PE=2 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 1.438e-58
Identity = 112/259 (43.24%), Postives = 167/259 (64.48%), Query Frame = 3
Query:   30 KHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDN--LSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQISLKY 800
            KHFV VHG+ HGAWCWY++ A L A GHR TA+D+AA+G +  R ++V +   YS PL++ +A+    E+++LVGHSLGG++LALA ++FP K++ AVF+ A MP         LE++  ++  + D ++D++    + +     ++L G + L  K+Y   PPEDL LA MLVRPG+ +ID+  +  E+  ++  YGSVKRV+LV  +D    ++ Q W I   P  EV E+ G DHMAM S P++LCD L +I+ KY
Sbjct:    6 KHFVFVHGLGHGAWCWYRVVAALRAAGHRATALDMAAAGAHPARADEVGSLEEYSRPLLDAVAAAAPGERLVLVGHSLGGLSLALAMERFPDKVAAAVFLAACMPAAGKHMGITLEEFMRRI--KPDFFMDSKTIVLNTNQEPRTAVLLGPKLLAEKLYNRSPPEDLTLATMLVRPGTNYIDDPIMKDETLLTEGNYGSVKRVFLVAMDDASSDEEMQRWTIDLSPGVEVEELAGADHMAMCSKPRELCDLLLRIAAKY 262          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: PIR7A_ORYSI (Probable esterase PIR7A OS=Oryza sativa subsp. indica GN=PIR7A PE=3 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 1.438e-58
Identity = 112/259 (43.24%), Postives = 167/259 (64.48%), Query Frame = 3
Query:   30 KHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDN--LSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQISLKY 800
            KHFV VHG+ HGAWCWY++ A L A GHR TA+D+AA+G +  R ++V +   YS PL++ +A+    E+++LVGHSLGG++LALA ++FP K++ AVF+ A MP         LE++  ++  + D ++D++    + +     ++L G + L  K+Y   PPEDL LA MLVRPG+ +ID+  +  E+  ++  YGSVKRV+LV  +D    ++ Q W I   P  EV E+ G DHMAM S P++LCD L +I+ KY
Sbjct:    6 KHFVFVHGLGHGAWCWYRVVAALRAAGHRATALDMAAAGAHPARADEVGSLEEYSRPLLDAVAAAAPGERLVLVGHSLGGLSLALAMERFPDKVAAAVFLAACMPAAGKHMGITLEEFMRRI--KPDFFMDSKTIVLNTNQEPRTAVLLGPKLLAEKLYNRSPPEDLTLATMLVRPGTNYIDDPIMKDETLLTEGNYGSVKRVFLVAMDDASSDEEMQRWTIDLSPGVEVEELAGADHMAMCSKPRELCDLLLRIAAKY 262          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: PIR7B_ORYSJ (Esterase PIR7B OS=Oryza sativa subsp. japonica GN=PIR7B PE=2 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 9.323e-58
Identity = 115/267 (43.07%), Postives = 168/267 (62.92%), Query Frame = 3
Query:    9 EVVGMEEKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAE-EKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDN--LSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQISLKY 800
            E+    +KHF+LVHG+ HGAWCWY++ A L A GHR TA+D+AASG +  R+++V TF  YS PL++ +A+  A  E+++LVGHS GG+++ALA ++FP K++ AVFV A MP          E++  +   E    +D +    + S  S +++  G  FL  K YQ  P EDL LAKMLVRPG+ F+D+  +  ES  ++  YGSVK+VY++ + D    ++ Q WM+   P  +V EI G DH  M S P++LCD L +I+ KY
Sbjct:    2 EISSSSKKHFILVHGLCHGAWCWYRVVAALRAAGHRATALDMAASGAHPARVDEVGTFEEYSRPLLDAVAAAAAPGERLVLVGHSHGGLSVALAMERFPDKVAAAVFVAAAMPCVGKHMGVPTEEFMRRTAPE-GLLMDCEMVAINNSQGSGVAINLGPTFLAQKYYQQSPAEDLALAKMLVRPGNQFMDDPVMKDESLLTNGNYGSVKKVYVIAKADSSSTEEMQRWMVAMSPGTDVEEIAGADHAVMNSKPRELCDILIKIANKY 267          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: PIR7B_ORYSI (Esterase PIR7B OS=Oryza sativa subsp. indica GN=PIR7B PE=3 SV=2)

HSP 1 Score: 223.787 bits (569), Expect = 9.323e-58
Identity = 115/267 (43.07%), Postives = 168/267 (62.92%), Query Frame = 3
Query:    9 EVVGMEEKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAE-EKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDN--LSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQISLKY 800
            E+    +KHF+LVHG+ HGAWCWY++ A L A GHR TA+D+AASG +  R+++V TF  YS PL++ +A+  A  E+++LVGHS GG+++ALA ++FP K++ AVFV A MP          E++  +   E    +D +    + S  S +++  G  FL  K YQ  P EDL LAKMLVRPG+ F+D+  +  ES  ++  YGSVK+VY++ + D    ++ Q WM+   P  +V EI G DH  M S P++LCD L +I+ KY
Sbjct:    2 EISSSSKKHFILVHGLCHGAWCWYRVVAALRAAGHRATALDMAASGAHPARVDEVGTFEEYSRPLLDAVAAAAAPGERLVLVGHSHGGLSVALAMERFPDKVAAAVFVAAAMPCVGKHMGVPTEEFMRRTAPE-GLLMDCEMVAINNSQGSGVAINLGPTFLAQKYYQQSPAEDLALAKMLVRPGNQFMDDPVMKDESLLTNGNYGSVKKVYVIAKADSSSTEEMQRWMVAMSPGTDVEEIAGADHAVMNSKPRELCDILIKIANKY 267          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: HNL_HEVBR (Hydroxynitrilase OS=Hevea brasiliensis GN=HNL PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 2.077e-57
Identity = 110/256 (42.97%), Postives = 164/256 (64.06%), Query Frame = 3
Query:   33 HFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDNLSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQISLKY 800
            HFVL+H + HGAW W+KLK  L A GH+VTA+DLAASG++ ++IE++ +F  YSEPL+  L +LP  EKVILVG S GG+ +A+AADK+  KI+ AVF  + +PDT H PS+V+++  E        W DT +            +  G   L   +Y LC PE+ ELAKML R GS+F + L+K   F+ EGYGS+K++Y+  ++D     +FQ W I+NY  ++V +++GGDH   L+  +++ + L +++  Y
Sbjct:    5 HFVLIHTICHGAWIWHKLKPLLEALGHKVTALDLAASGVDPRQIEEIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPSYVVDKLMEVF----PDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGPEEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSIKKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGGDHKLQLTKTKEIAEILQEVADTY 256          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: HNL_MANES (Hydroxynitrilase OS=Manihot esculenta GN=HNL PE=1 SV=3)

HSP 1 Score: 211.46 bits (537), Expect = 4.788e-54
Identity = 104/262 (39.69%), Postives = 164/262 (62.60%), Query Frame = 3
Query:   21 MEEKHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQ-FSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDNLSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQISLKYA 803
            M   HFVL+H + HGAW W+KLK  L   GH+VTA+D+AASGI+ ++IE +++F  YSEPL+  L  LP  EKVI+VG S  G+ +A+AAD++  KI+  VF  + +PDT H PS+ +E+  E        W DT+ F+  + +  +  +M  G   L   ++  C   + ELAKM++R GS+F + L++  KF+++GYGS+K+VY+  ++D      FQ W I NY  ++V +++GGDH   L+  +++   L +++  YA
Sbjct:    1 MVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESF----PDWRDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA 258          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: Y1399_ARATH (Probable esterase At1g33990 OS=Arabidopsis thaliana GN=At1g33990 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.003e-35
Identity = 89/255 (34.90%), Postives = 133/255 (52.16%), Query Frame = 3
Query:   30 KHFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQF-SQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDNLSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKLCDCLSQIS 791
            K FVLVHG   GAWCWYK+ A L   G     VDL   G NM     V T   YS+PL+++L +LP EEKVILVGHS GG +++ A ++FP KIS A+FV A M     RP    + +SE++G  +    ++QF    +  +      +F +  +    +   P +D+ LA + +RP  + +  + ++   + E YG  +R Y+   +D  L    Q  +++      V +IKG DH    S PQ L   L +I+
Sbjct:   96 KKFVLVHGEGFGAWCWYKMVASLEESGLSPVTVDLTGCGFNMTDTNTVSTLEEYSKPLIDLLENLPEEEKVILVGHSTGGASISYALERFPEKISKAIFVCATMVSDGQRP---FDVFSEELGSAERFMKESQFLIYGNGKDKPPTGFMFEKPHMKGLYFNQSPNKDIALAMISMRP--VPLGPMMEKVSLTAERYGKGRRFYVQTLDDRALSPDVQEKLVRENSPEGVFKIKGSDHCPFFSKPQSLHKILLEIA 345          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: PPD_RAPSA (Pheophorbidase OS=Raphanus sativus GN=PPD PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 7.439e-31
Identity = 84/247 (34.01%), Postives = 124/247 (50.20%), Query Frame = 3
Query:   33 HFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMG-KEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSMFIDNLSKESKFSDEGYG-SVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKL 767
            HFV VHG +HGAWCWYKL   LVA G + T+VDL  +GIN+     V  F  Y+ PL  +L+ LP+  K++LVGHS+GG ++  A  KF  KIS+ V++ A M     +P      +   M   E+D W   ++   + ++     +L   EF     Y   P ED+ LA  L+RP    +  L    K S       V RVY+   +D       Q  +++ +P +++  ++  DH A  S P  L
Sbjct:   13 HFVFVHGASHGAWCWYKLTTLLVAAGFKATSVDLTGAGINLTDSNTVFDFDHYNRPLFSLLSDLPSHHKIVLVGHSIGGGSVTEALCKFTDKISMVVYLAADMV----QPGSTSSTHDSIMTVGEEDIW---EYIYGEGADKPPTGVLMKEEFRRHYYYSQSPLEDVSLASKLLRPAP--VRALGGADKLSPNPEAEKVPRVYIKTAKDNLFDPLRQDRLVEKWPPSQLYILEESDHSAFFSVPTTL 250          
BLAST of DC900413 vs. ExPASy Swiss-Prot
Match: PPD_ARATH (Probable pheophorbidase OS=Arabidopsis thaliana GN=PPD PE=2 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 2.164e-30
Identity = 84/249 (33.73%), Postives = 125/249 (50.20%), Query Frame = 3
Query:   33 HFVLVHGVNHGAWCWYKLKARLVAGGHRVTAVDLAASGINMKRIEDVHTFHAYSEPLMEVLASLPAEEKVILVGHSLGGVTLALAADKFPHKISVAVFVTAFMPDTTHRPSFVLEQYSEKMGKEDDSWLDTQFSQCDASNPSHISMLFGREFLTIKIYQLCPPEDLELAKMLVRPGSM----FIDNLSKESKFSDEGYGSVKRVYLVCEEDIGLPKQFQHWMIQNYPVNEVMEIKGGDHMAMLSDPQKL 767
            HFV VHG +HGAWCWYKL   L A G + T+VDL  +GI++     V     Y+ PL  +L+ LP   KVILVGHS+GG ++  A  KF  KIS+A+++ A M      PS      S     E+D W   +++  + ++     +L   EF+    Y   P ED+ L+  L+RP  M     +D L    +        V RVY+   +D       Q  +++N+P +++  ++  DH A  S P  L
Sbjct:   12 HFVFVHGASHGAWCWYKLTTLLDAAGFKSTSVDLTGAGISLIDSNIVFDSDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAASMVQPGSIPS---PHLSNIHVGEEDIW---EYTYGEGTDKPPTGVLMKPEFIRHYYYSQSPLEDVTLSSKLLRPAPMRAFQDLDKLPPNPEAE-----KVPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDSDHSAFFSVPTTL 249          
The following BLAST results are available for this feature:
BLAST of DC900413 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
PNAE_RAUSE4.451e-7653.13Polyneuridine-aldehyde esterase OS=Rauvolfia serpe... [more]
PIR7A_ORYSJ1.438e-5843.24Probable esterase PIR7A OS=Oryza sativa subsp. jap... [more]
PIR7A_ORYSI1.438e-5843.24Probable esterase PIR7A OS=Oryza sativa subsp. ind... [more]
PIR7B_ORYSJ9.323e-5843.07Esterase PIR7B OS=Oryza sativa subsp. japonica GN=... [more]
PIR7B_ORYSI9.323e-5843.07Esterase PIR7B OS=Oryza sativa subsp. indica GN=PI... [more]
HNL_HEVBR2.077e-5742.97Hydroxynitrilase OS=Hevea brasiliensis GN=HNL PE=1... [more]
HNL_MANES4.788e-5439.69Hydroxynitrilase OS=Manihot esculenta GN=HNL PE=1 ... [more]
Y1399_ARATH1.003e-3534.90Probable esterase At1g33990 OS=Arabidopsis thalian... [more]
PPD_RAPSA7.439e-3134.01Pheophorbidase OS=Raphanus sativus GN=PPD PE=1 SV=... [more]
PPD_ARATH2.164e-3033.73Probable pheophorbidase OS=Arabidopsis thaliana GN... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900413 VSS Citrus sinensis cDNA clone VS28993 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900413 ID=DC900413|Name=DC900413|organism=Citrus sinensis|type=EST|length=829bp
AAATGGAAGAAGTAGTAGGCATGGAAGAGAAGCATTTTGTTCTAGTTCAT
GGAGTAAACCATGGAGCATGGTGTTGGTACAAACTGAAAGCAAGGCTGGT
GGCGGGGGGTCACCGGGTGACGGCTGTGGACCTAGCCGCCTCGGGCATCA
ACATGAAGAGAATTGAGGATGTGCACACATTCCATGCATACAGTGAGCCC
TTGATGGAGGTTTTGGCATCACTTCCTGCCGAAGAAAAGGTCATACTTGT
CGGACACAGTCTTGGGGGCGTCACTTTGGCCCTTGCCGCCGACAAATTCC
CACACAAAATCTCCGTGGCTGTTTTCGTAACTGCATTCATGCCTGACACC
ACACACCGCCCATCTTTTGTTTTGGAGCAGTATTCTGAGAAGATGGGAAA
AGAGGACGACAGCTGGTTGGACACTCAATTTTCACAATGTGACGCGTCAA
ATCCATCTCACATTTCCATGCTTTTCGGCCGCGAGTTCTTGACTATCAAG
ATCTATCAGCTTTGTCCTCCTGAGGATCTGGAGCTGGCCAAGATGTTGGT
GAGGCCAGGATCAATGTTTATAGACAACTTATCGAAGGAAAGTAAGTTCA
GCGATGAAGGATACGGATCTGTTAAGCGAGTTTATCTTGTATGCGAAGAG
GATATTGGTCTCCCTAAGCAATTTCAGCACTGGATGATCCAAAACTATCC
CGTTAATGAAGTGATGGAGATCAAGGGCGGTGATCACATGGCAATGCTTT
CCGACCCACAGAAACTTTGCGATTGTCTGTCTCAGATTTCTCTTAAGTAT
GCATAAAATTAATCTTGTCAGATGCTTTT
back to top