DC900411

Overview
NameDC900411
Unique NameDC900411
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length615
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900411_ssr6 microsatellite DC900411_ssr6:6..17. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900411 vs. ExPASy Swiss-Prot
Match: SERK2_ARATH (Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 1.427e-43
Identity = 66/83 (79.52%), Postives = 69/83 (83.13%), Query Frame = 2
Query:    2 ANDDDVMLLDWVXXXXXXXXXXXXVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWDEWQKVEV 250
            ANDDDVMLLDWV            VDPDLQ+NY EAEVEQLIQVALLCTQ SPM+RPKMSEVVRMLEGDGLAE+WDEWQKVEV
Sbjct:  514 ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQSNYTEAEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAEKWDEWQKVEV 596          

HSP 2 Score: 60.077 bits (144), Expect = 1.427e-43
Identity = 26/32 (81.25%), Postives = 30/32 (93.75%), Query Frame = 3
Query:  252 LRQEVELAPHPNSDWIVDSTENLHAVELSGPR 347
            LRQEVEL+ HP SDWI+DST+NLHA+ELSGPR
Sbjct:  597 LRQEVELSSHPTSDWILDSTDNLHAMELSGPR 628          
BLAST of DC900411 vs. ExPASy Swiss-Prot
Match: SERK1_ARATH (Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 1.546e-42
Identity = 63/83 (75.90%), Postives = 68/83 (81.93%), Query Frame = 2
Query:    2 ANDDDVMLLDWVXXXXXXXXXXXXVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWDEWQKVEV 250
            ANDDDVMLLDWV            VDPDLQ NY E E+EQ+IQVALLCTQGSPM+RPKMSEVVRMLEGDGLAE+WDEWQKVE+
Sbjct:  511 ANDDDVMLLDWVKGLLKEKKLEMLVDPDLQTNYEERELEQVIQVALLCTQGSPMERPKMSEVVRMLEGDGLAEKWDEWQKVEI 593          

HSP 2 Score: 60.077 bits (144), Expect = 1.546e-42
Identity = 25/34 (73.53%), Postives = 32/34 (94.12%), Query Frame = 3
Query:  246 KFLRQEVELAPHPNSDWIVDSTENLHAVELSGPR 347
            + LR+E++L+P+PNSDWI+DST NLHAVELSGPR
Sbjct:  592 EILREEIDLSPNPNSDWILDSTYNLHAVELSGPR 625          
BLAST of DC900411 vs. ExPASy Swiss-Prot
Match: BAK1_ARATH (BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2)

HSP 1 Score: 124.405 bits (311), Expect = 4.482e-28
Identity = 61/83 (73.49%), Postives = 65/83 (78.31%), Query Frame = 2
Query:    2 ANDDDVMLLDWVXXXXXXXXXXXXVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWDEWQKVEV 250
            ANDDDVMLLDWV            VD DLQ NY + EVEQLIQVALLCTQ SPM+RPKMSEVVRMLEGDGLAERW+EWQK E+
Sbjct:  498 ANDDDVMLLDWVKGLLKEKKLEALVDVDLQGNYKDEEVEQLIQVALLCTQSSPMERPKMSEVVRMLEGDGLAERWEEWQKEEM 580          
BLAST of DC900411 vs. ExPASy Swiss-Prot
Match: SERK5_ARATH (Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.883e-26
Identity = 57/83 (68.67%), Postives = 64/83 (77.11%), Query Frame = 2
Query:    2 ANDDDVMLLDWVXXXXXXXXXXXXVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWDEWQKVEV 250
            ANDDD+MLLDWV            VD +L+  YVE EVEQLIQ+ALLCTQ S M+RPKMSEVVRMLEGDGLAERW+EWQK E+
Sbjct:  484 ANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLEGDGLAERWEEWQKEEM 566          
BLAST of DC900411 vs. ExPASy Swiss-Prot
Match: SERK4_ARATH (Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.883e-26
Identity = 57/83 (68.67%), Postives = 64/83 (77.11%), Query Frame = 2
Query:    2 ANDDDVMLLDWVXXXXXXXXXXXXVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWDEWQKVEV 250
            ANDDD+MLLDWV            VD +L+  YVE EVEQLIQ+ALLCTQ S M+RPKMSEVVRMLEGDGLAERW+EWQK E+
Sbjct:  503 ANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEVEQLIQMALLCTQSSAMERPKMSEVVRMLEGDGLAERWEEWQKEEM 585          
BLAST of DC900411 vs. ExPASy Swiss-Prot
Match: Y5129_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At5g10290 OS=Arabidopsis thaliana GN=At5g10290 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.304e-23
Identity = 51/81 (62.96%), Postives = 59/81 (72.84%), Query Frame = 2
Query:    8 DDDVMLLDWVXXXXXXXXXXXXVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERWDEWQKVEV 250
            +DDV+LLD V            VD +L   Y++ EVE +IQVALLCTQGSP DRP MSEVVRMLEG+GLAERW+EWQ VEV
Sbjct:  501 EDDVLLLDHVKKLEREKRLGAIVDKNLDGEYIKEEVEMMIQVALLCTQGSPEDRPVMSEVVRMLEGEGLAERWEEWQNVEV 581          

HSP 2 Score: 24.6386 bits (52), Expect = 1.304e-23
Identity = 11/19 (57.89%), Postives = 12/19 (63.16%), Query Frame = 3
Query:  291 DWIVDSTENLHAVELSGPR 347
            DW  DS  N  A+ELSG R
Sbjct:  595 DWGEDSMHNQDAIELSGGR 613          
BLAST of DC900411 vs. ExPASy Swiss-Prot
Match: Y2239_ARATH (Probable LRR receptor-like serine/threonine-protein kinase At2g23950 OS=Arabidopsis thaliana GN=At2g23950 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 6.948e-13
Identity = 37/68 (54.41%), Postives = 44/68 (64.71%), Query Frame = 2
Query:   23 LLDWVXXXXXXXXXXXXVDPDLQNNYVEAEVEQLIQVALLCTQGSPMDRPKMSEVVRMLEGDGLAERW 226
            +L+WV            VD +L   Y   EV +++QVALLCTQ  P  RPKMSEVV+MLEGDGLAERW
Sbjct:  510 MLEWVRKLHKEMKVEELVDRELGTTYDRIEVGEMLQVALLCTQFLPAHRPKMSEVVQMLEGDGLAERW 577          
The following BLAST results are available for this feature:
BLAST of DC900411 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
SERK2_ARATH1.427e-4379.52Somatic embryogenesis receptor kinase 2 OS=Arabido... [more]
SERK1_ARATH1.546e-4275.90Somatic embryogenesis receptor kinase 1 OS=Arabido... [more]
BAK1_ARATH4.482e-2873.49BRASSINOSTEROID INSENSITIVE 1-associated receptor ... [more]
SERK5_ARATH1.883e-2668.67Somatic embryogenesis receptor kinase 5 OS=Arabido... [more]
SERK4_ARATH1.883e-2668.67Somatic embryogenesis receptor kinase 4 OS=Arabido... [more]
Y5129_ARATH1.304e-2362.96Probable LRR receptor-like serine/threonine-protei... [more]
Y2239_ARATH6.948e-1354.41Probable LRR receptor-like serine/threonine-protei... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900411 VSS Citrus sinensis cDNA clone VS28988 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900411 ID=DC900411|Name=DC900411|organism=Citrus sinensis|type=EST|length=615bp
GGCAAATGATGATGATGTCATGCTGCTTGATTGGGTGAAAGGACTTCTGA
AGGAAAAGAAGTTAGAAATGCTAGTTGACCCTGATCTCCAGAACAATTAT
GTGGAAGCTGAGGTGGAGCAACTTATCCAGGTTGCGTTGCTCTGCACTCA
AGGCTCCCCTATGGACCGGCCCAAGATGTCGGAAGTTGTTAGAATGCTTG
AAGGTGATGGCTTGGCAGAGCGGTGGGATGAGTGGCAAAAGGTGGAAGTT
TCTCCGCCAAGAAGTAGAATTAGCCCCTCATCCTAATTCAGATTGGATAG
TTGACTCAACAGAAAATCTTCATGCCGTTGAGTTATCTGGTCCAAGGTGA
CCCTGTCACTCCTATTAGCTATAAGTAAAGAGGAAAATTTTACTACTTTT
TTTTATTCCTTTTTTTAATCATAATTTTTCTTCTTTTTTTTTTTTTTAAA
TTTAACGATGATATCCTGATTTCTGTAAGCCCTTCAGCATTGTATTCATT
ACACTTGTGCATATGTATCATTTGGTCATGGTGCAATTTGTATCCCCAGC
CGCAGTTTGACAGACTCTTTTGATGTTTTTAAATAGATGGGAGCTGTGGC
AACACCTTATATTCA
back to top