DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.023e-45
Identity = 81/129 (62.79%), Postives = 103/129 (79.84%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG---RGMCGMNTM 438
            YPY G  GKC+FD  KI   V NF+ + VDE QI+A+L+ HGPLAIG+NA +MQTYIGGVSCP ICG+  L+HGVLLVGYGA GF+ +RL ++PYWIIKNSWG+ WG++GYY++CRG   R  CG+++M
Sbjct:  232 YPYTGSDGKCKFDKSKIVASVQNFSVVSVDEAQISANLIKHGPLAIGINAAYMQTYIGGVSCPYICGRH-LDHGVLLVGYGASGFAPIRLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSM 359          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.198e-42
Identity = 76/127 (59.84%), Postives = 101/127 (79.53%), Query Frame = 1
Query:   61 YPYIGKRGK-CQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            YPY GK GK C+ D  KI   V+NF+ I +DE QIAA+LV +GPLA+ +NA +MQTYIGGVSCP IC ++ LNHGVLLVGYGA G++  R   +PYWIIKNSWG+ WG++G+Y++C+GR +CG+++M
Sbjct:  230 YPYTGKDGKTCKLDKSKIVASVSNFSVISIDEEQIAANLVKNGPLAVAINAGYMQTYIGGVSCPYICTRR-LNHGVLLVGYGAAGYAPARFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSM 355          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.975e-41
Identity = 69/126 (54.76%), Postives = 98/126 (77.78%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            Y Y G+ G C+FD  K+   V+NF+ + +DE+QIAA+LV +GPLA+ +NA +MQTY+ GVSCP +C K  L+HGVLLVG+G   ++ +RL  +PYWIIKNSWG+ WG+ GYY++CRGR +CG+++M
Sbjct:  227 YAYTGRDGSCKFDKSKVVASVSNFSVVTLDEDQIAANLVKNGPLAVAINAAWMQTYMSGVSCPYVCAKSRLDHGVLLVGFGKGAYAPIRLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSM 352          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2)

HSP 1 Score: 167.933 bits (424), Expect = 4.401e-41
Identity = 72/127 (56.69%), Postives = 101/127 (79.53%), Query Frame = 1
Query:   61 YPYIGKRG-KCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            YPY G  G  C+ D  KI   V+NF+ + ++E+QIAA+L+ +GPLA+ +NA +MQTYIGGVSCP IC ++ LNHGVLLVGYG+ GFS  RL  +PYWIIKNSWG+ WG++G+Y++C+GR +CG++++
Sbjct:  227 YPYTGTDGGSCKLDRSKIVASVSNFSVVSINEDQIAANLIKNGPLAVAINAAYMQTYIGGVSCPYICSRR-LNHGVLLVGYGSAGFSQARLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSL 352          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: PAPA5_CARPA (Cysteine proteinase (Fragment) OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.128e-31
Identity = 54/85 (63.53%), Postives = 74/85 (87.06%), Query Frame = 1
Query:  184 GPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            GPLA+ +NA +MQTYIGGVSCP IC ++ LNHGVLLVGYG+ G++ +RL  +PYW+IKNSWG+ WG++GYY++CRGR +CG+++M
Sbjct:    1 GPLAVAINAAYMQTYIGGVSCPYICSRR-LNHGVLLVGYGSAGYAPIRLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSM 84          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL_SCHMA (Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.517e-28
Identity = 55/129 (42.64%), Postives = 84/129 (65.12%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCP--LICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            +YPY  K  KC   ++ +AV + +  N+  DE ++AA L H+  +++G+NA+ +Q Y  G+S P  + C K  L+H VLLVGYG          N+P+WI+KNSWG +WG++GY+R+ RG G CG+NT+
Sbjct:  190 NYPYDAKNEKCHLKTDGVAVYINSSVNLTQDETELAAWLYHNSTISVGMNALLLQFYQHGISHPWWIFCSKYLLDHAVLLVGYGVSE------KNEPFWIVKNSWGVEWGENGYFRMYRGDGSCGINTV 312          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP1_DICDI (Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 4.723e-27
Identity = 61/127 (48.03%), Postives = 83/127 (65.35%), Query Frame = 1
Query:   55 SSYPYIGKRG-KCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMN 432
            SSYPY  + G +C F+S  I  +++NFT IP +E  +A ++V  GPLAI  +A+  Q YIGGV   + C    L+HG+L+VGY AK  +I R  N PYWI+KNSWG  WG+ GY  L RG+  CG++
Sbjct:  212 SSYPYTAETGTQCNFNSANIGAKISNFTMIPKNETVMAGYIVSTGPLAIAADAVEWQFYIGGVF-DIPCNPNSLDHGILIVGYSAKN-TIFRK-NMPYWIVKNSWGADWGEQGYIYLRRGKNTCGVS 335          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CPR1_DROME (Putative cysteine proteinase CG12163 OS=Drosophila melanogaster GN=CG12163 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 2.344e-26
Identity = 59/131 (45.04%), Postives = 83/131 (63.36%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCP--LICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            + YPY  K+ +C F+     V+VA F ++P  +E  +   L+ +GP++IG+NA  MQ Y GGVS P   +C KK L+HGVL+VGYG   +        PYWI+KNSWG +WG+ GYYR+ RG   CG++ M
Sbjct:  478 AEYPYKAKKNQCHFNRTLSHVQVAGFVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGVSDYPNFHK-TLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEM 607          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATF_MOUSE (Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.422e-23
Identity = 54/128 (42.19%), Postives = 74/128 (57.81%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPL--ICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            Y Y G    C F ++   V + +   +  +EN+IAA L   GP+++ +NA  MQ Y  G++ P   +C   +++H VLLVGYG +        N PYW IKNSWG  WG+ GYY L RG G CG+NTM
Sbjct:  335 YGYQGHVQTCNFSAQMAKVYINDSVELSRNENKIAAWLAQKGPISVAINAFGMQFYRHGIAHPFRPLCSPWFIDHAVLLVGYGNRS-------NIPYWAIKNSWGSDWGEEGYYYLYRGSGACGVNTM 455          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATF_HUMAN (Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.857e-23
Identity = 54/128 (42.19%), Postives = 74/128 (57.81%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPL--ICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNTM 438
            Y Y G    C F +EK  V + +   +  +E ++AA L   GP+++ +NA  MQ Y  G+S PL  +C    ++H VLLVGYG +        + P+W IKNSWG  WG+ GYY L RG G CG+NTM
Sbjct:  357 YSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRS-------DVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTM 477          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CYSP1_MAIZE5.023e-4562.79Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=... [more]
RD19A_ARATH5.198e-4259.84Cysteine proteinase RD19a OS=Arabidopsis thaliana ... [more]
CYSP_PEA1.975e-4154.76Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1[more]
A494_ARATH4.401e-4156.69Probable cysteine proteinase A494 OS=Arabidopsis t... [more]
PAPA5_CARPA4.128e-3163.53Cysteine proteinase (Fragment) OS=Carica papaya PE... [more]
CATL_SCHMA9.517e-2842.64Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=... [more]
CYSP1_DICDI4.723e-2748.03Cysteine proteinase 1 OS=Dictyostelium discoideum ... [more]
CPR1_DROME2.344e-2645.04Putative cysteine proteinase CG12163 OS=Drosophila... [more]
CATF_MOUSE1.422e-2342.19Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1[more]
CATF_HUMAN1.857e-2342.19Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top