DC900407

Overview
NameDC900407
Unique NameDC900407
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length162
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: CATL_SCHMA (Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.520e-14
Identity = 32/43 (74.42%), Postives = 36/43 (83.72%), Query Frame = 2
Query:   23 EIDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFF 151
            E++  P+NFDWREKGAVTEVK QG CGSCWAFSTTG VE  +F
Sbjct:  101 EVNNIPKNFDWREKGAVTEVKNQGMCGSCWAFSTTGNVESQWF 143          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: CYSP_PEA (Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.624e-13
Identity = 32/39 (82.05%), Postives = 36/39 (92.31%), Query Frame = 2
Query:   38 PENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            PE+FDWREKGAVT VK QG+CGSCWAFSTTGA+EGA +L
Sbjct:  133 PEDFDWREKGAVTPVKDQGSCGSCWAFSTTGALEGAHYL 171          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: A494_ARATH (Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.170e-13
Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 2
Query:   17 MMEIDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            ++     PE FDWR++GAVT VK QG+CGSCW+FSTTGA+EGA FL
Sbjct:  126 ILPTQNLPEEFDWRDRGAVTPVKNQGSCGSCWSFSTTGALEGAHFL 171          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: RD19A_ARATH (Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 4.000e-12
Identity = 29/46 (63.04%), Postives = 37/46 (80.43%), Query Frame = 2
Query:   17 MMEIDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            ++  +  PE+FDWR+ GAVT VK QG+CGSCW+FS TGA+EGA FL
Sbjct:  129 ILPTENLPEDFDWRDHGAVTPVKNQGSCGSCWSFSATGALEGANFL 174          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: CYSP1_MAIZE (Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.520e-11
Identity = 27/46 (58.70%), Postives = 37/46 (80.43%), Query Frame = 2
Query:   17 MMEIDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            ++  DG P++FDWR+ GAV  VK QG+CGSCW+FS +GA+EGA +L
Sbjct:  131 VLPTDGLPDDFDWRDHGAVGPVKNQGSCGSCWSFSASGALEGAHYL 176          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.592e-11
Identity = 29/38 (76.32%), Postives = 31/38 (81.58%), Query Frame = 2
Query:   29 DGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEG 142
            D  PE+ DWR+KGAV EVK QG CGSCWAFST GAVEG
Sbjct:  135 DELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEG 172          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: CATF_MOUSE (Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.592e-11
Identity = 29/39 (74.36%), Postives = 32/39 (82.05%), Query Frame = 2
Query:   38 PENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            P  +DWR+KGAVTEVK QG CGSCWAFS TG VEG +FL
Sbjct:  250 PPEWDWRKKGAVTEVKNQGMCGSCWAFSVTGNVEGQWFL 288          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: CATS_RAT (Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.386e-11
Identity = 29/52 (55.77%), Postives = 36/52 (69.23%), Query Frame = 2
Query:    2 SGSVKMMEIDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFLR 157
            SG++K       P++ DWREKG VT VK QG+CGSCWAFS  GA+EG   L+
Sbjct:  102 SGTLKSSSNQTLPDSVDWREKGCVTNVKYQGSCGSCWAFSAEGALEGQLKLK 153          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: LMCPB_LEIME (Cysteine proteinase B OS=Leishmania mexicana GN=LMCPB PE=2 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 2
Query:   23 EIDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            ++   P+  DWREKGAVT VK QGACGSCWAFS  G +EG ++L
Sbjct:  122 DLSAVPDAVDWREKGAVTPVKDQGACGSCWAFSAVGNIEGQWYL 165          
BLAST of DC900407 vs. ExPASy Swiss-Prot
Match: CYSP2_LEIPI (Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS2 PE=1 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.851e-11
Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 2
Query:   23 EIDGFPENFDWREKGAVTEVKMQGACGSCWAFSTTGAVEGAFFL 154
            ++   P+  DWREKGAVT VK QGACGSCWAFS  G +EG ++L
Sbjct:  122 DLSAVPDAVDWREKGAVTPVKDQGACGSCWAFSAVGNIEGQWYL 165          
The following BLAST results are available for this feature:
BLAST of DC900407 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
CATL_SCHMA9.520e-1474.42Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=... [more]
CYSP_PEA1.624e-1382.05Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1[more]
A494_ARATH6.170e-1365.22Probable cysteine proteinase A494 OS=Arabidopsis t... [more]
RD19A_ARATH4.000e-1263.04Cysteine proteinase RD19a OS=Arabidopsis thaliana ... [more]
CYSP1_MAIZE1.520e-1158.70Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=... [more]
RD21A_ARATH2.592e-1176.32Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
CATF_MOUSE2.592e-1174.36Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1[more]
CATS_RAT3.386e-1155.77Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1[more]
LMCPB_LEIME9.851e-1161.36Cysteine proteinase B OS=Leishmania mexicana GN=LM... [more]
CYSP2_LEIPI9.851e-1161.36Cysteine proteinase 2 OS=Leishmania pifanoi GN=CYS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900407 VSS Citrus sinensis cDNA clone VS28985 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900407 ID=DC900407|Name=DC900407|organism=Citrus sinensis|type=EST|length=162bp
GAGTGGTAGTGTAAAGATGATGGAGATTGATGGATTTCCTGAGAATTTTG
ATTGGAGAGAAAAAGGTGCTGTCACTGAGGTCAAGATGCAGGGAGCATGT
GGGTCATGCTGGGCTTTTAGCACTACAGGAGCTGTTGAAGGAGCCTTTTT
TTTGCGACTGGG
back to top