DC900406

Overview
NameDC900406
Unique NameDC900406
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1245
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3957 contig Csv1_Contig3957:1364..2608. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA1_RICCO (Phospholipase D alpha 1 OS=Ricinus communis GN=PLD1 PE=1 SV=1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 310/351 (88.32%), Postives = 334/351 (95.16%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            + WNVQLFRSIDGGAAFGFPETPEDA  AGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSF WS DGIKPE+INALHLIPKELSLKI+SKI AGERFTVYIVVPMWPEG PES SVQAILDWQ+RTM+MMYKD+VQAL+A GI+EDPRNYLTFFCLGNREVK+SGEYEPAE+PE D+DY+RAQEARRFMIYVH KMMIVDDEYIIIGSANINQRSM+GARD+EIAMG YQP+HLSTR PARGQIHGFRMSLWYEHLGMLD++FL PES ECV+KVNQ+AE+YWDLYSSE+LEHDLPGHLLRYPIGV+ EGDVTELPGTEFFPDTKARVLG KSDY+PP+LTT
Sbjct:  458 EAWNVQLFRSIDGGAAFGFPETPEDAPEAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFGWSPDGIKPEDINALHLIPKELSLKILSKIAAGERFTVYIVVPMWPEGIPESASVQAILDWQKRTMEMMYKDIVQALKANGIIEDPRNYLTFFCLGNREVKKSGEYEPAEKPEPDTDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPHHLSTRQPARGQIHGFRMSLWYEHLGMLDESFLNPESEECVRKVNQMAEKYWDLYSSETLEHDLPGHLLRYPIGVASEGDVTELPGTEFFPDTKARVLGAKSDYLPPILTT 808          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA1_ARATH (Phospholipase D alpha 1 OS=Arabidopsis thaliana GN=PLDALPHA1 PE=1 SV=2)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 300/351 (85.47%), Postives = 331/351 (94.30%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            D WNVQLFRSIDGGAA GFPE+PE AA AGLVSGKDNIIDRSIQDAYIHAIRRAK+FIY+ENQYFLGSSFAW+ADGI PE+INALHLIPKELSLKIVSKIE GE+F VY+VVPMWPEG PESGSVQAILDWQRRTM+MMYKDV+QALRA+G+ EDPRNYLTFFCLGNREVK+ GEYEPAE+P+ D+DY+RAQEARRFMIYVH KMMIVDDEYIIIGSANINQRSM+GARD+EIAMGGYQP+HLS R PARGQIHGFRMSLWYEHLGMLD+TFL P S EC++KVN+I+++YWD YSSESLEHDLPGHLLRYPIGV+ EGD+TELPG EFFPDTKAR+LGTKSDY+PP+LTT
Sbjct:  460 DVWNVQLFRSIDGGAAAGFPESPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYVENQYFLGSSFAWAADGITPEDINALHLIPKELSLKIVSKIEKGEKFRVYVVVPMWPEGLPESGSVQAILDWQRRTMEMMYKDVIQALRAQGLEEDPRNYLTFFCLGNREVKKDGEYEPAEKPDPDTDYMRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRISDKYWDFYSSESLEHDLPGHLLRYPIGVASEGDITELPGFEFFPDTKARILGTKSDYLPPILTT 810          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA2_ARATH (Phospholipase D alpha 2 OS=Arabidopsis thaliana GN=PLDALPHA2 PE=2 SV=1)

HSP 1 Score: 636.721 bits (1641), Expect = 0.000e+0
Identity = 300/352 (85.23%), Postives = 332/352 (94.32%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIM-EDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            D WNVQLFRSIDGGAA GFP++PE AA AGLVSGKDNIIDRSIQDAYIHAIRRAK+FIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKI+AGE+F VY+VVPMWPEG PESGSVQAILDWQ+RTM+MMYKDV++ALR  G+  EDPR+YLTFFCLGNREVK+ GEYEP+E+PE D+DY+RAQEARRFMIYVH KMMIVDDEYIIIGSANINQRSM+GARD+EIAMGGYQPYHLSTR PARGQIHGFRMSLWYEHLGMLD+TFL P S EC++KVN++A++YWDLYSSESLEHDLPGHLLRYPIG++ EG++TELPG EFFPDTKAR+LG KSDYMPP+LTT
Sbjct:  459 DVWNVQLFRSIDGGAAAGFPDSPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIKAGEKFKVYVVVPMWPEGIPESGSVQAILDWQKRTMEMMYKDVIKALRENGLEGEDPRDYLTFFCLGNREVKKDGEYEPSEKPEPDTDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLSTRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSQECIQKVNRVADKYWDLYSSESLEHDLPGHLLRYPIGIASEGNITELPGCEFFPDTKARILGVKSDYMPPILTT 810          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA1_BRAOC (Phospholipase D alpha 1 OS=Brassica oleracea var. capitata GN=PLD1 PE=2 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 300/351 (85.47%), Postives = 327/351 (93.16%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            D WNVQLFRSIDGGAA GFPE+PE AA AGLVSGKDNIIDRSIQDAYIHAIRRAK+FIYIENQYFLGSSFAW+ADGI PE+INALHLIPKELSLKIVSKIE GE+F VY+VVPMWPEG PES SVQAILDWQRRTM MMYKD+VQALRA+G+ EDPRNYLTFFCLGNREVK+ GEYEPAERP+ DS Y++AQEARRFMIYVH KMMIVDDEYIIIGSANINQRSM+GARD+EIAMGGYQP+HLS R PARGQIHGFRMSLWYEHLGMLD+TFL P S EC++KVN+I+++YWDLYSSESLEHDLPGHLLRYP+ V GEGDVTE PG EFFPDTKAR+LGTKSDY+PP+LTT
Sbjct:  460 DVWNVQLFRSIDGGAAAGFPESPEAAAEAGLVSGKDNIIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWAADGITPEDINALHLIPKELSLKIVSKIEKGEKFRVYVVVPMWPEGLPESASVQAILDWQRRTMQMMYKDIVQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDADSSYMKAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQIHGFRMSLWYEHLGMLDETFLDPSSVECIEKVNRISDKYWDLYSSESLEHDLPGHLLRYPVDVDGEGDVTEFPGFEFFPDTKARILGTKSDYLPPILTT 810          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA1_VIGUN (Phospholipase D alpha 1 OS=Vigna unguiculata GN=PLD1 PE=2 SV=1)

HSP 1 Score: 633.639 bits (1633), Expect = 0.000e+0
Identity = 302/351 (86.04%), Postives = 328/351 (93.45%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            +TWNVQLFRSIDGGAAFGFP+TPEDAA+AGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSF+W+ D IK EEI ALHLIPKELSLKIVSKIEAGERF VY+VVPMWPEG PES SVQAILDWQ+RT++MMYKDVVQALRAKG  EDPRNYLTFFCLGNREVK+SGEYEPAE+PE DSDY RAQEARRFMIYVH KMMIVDDEYIIIGSANINQRSM+GARD+EIAMGGYQPYHL+   PARGQ++GFRMSLWYEHLGML DTF +PES EC+ KVNQIA++YWDLYSSESLE DLPGHLLRYPIGV+ EG+VTELPG EFFPDTKAR+LG K+DY+PP+LTT
Sbjct:  459 ETWNVQLFRSIDGGAAFGFPDTPEDAAKAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFSWNNDDIKREEIGALHLIPKELSLKIVSKIEAGERFAVYVVVPMWPEGIPESSSVQAILDWQKRTIEMMYKDVVQALRAKGSDEDPRNYLTFFCLGNREVKKSGEYEPAEQPEPDSDYQRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLANTQPARGQVYGFRMSLWYEHLGMLHDTFQRPESEECINKVNQIADKYWDLYSSESLERDLPGHLLRYPIGVASEGEVTELPGFEFFPDTKARILGAKADYLPPILTT 809          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA1_TOBAC (Phospholipase D alpha 1 OS=Nicotiana tabacum GN=PLD1 PE=2 SV=2)

HSP 1 Score: 628.632 bits (1620), Expect = 2.260e-179
Identity = 298/351 (84.90%), Postives = 327/351 (93.16%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            +TWNVQLFRSID GAAFGFPETPEDAA+AGLVSG DNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSS+ W +D IK E+I ALH+IPKEL+LKIVSKIEAGERFTVY+VVPMWPEG PES SVQAILDWQRRTM+MMYK +VQAL AKGI EDPRNYLTFFC+GNREVK+SG YEP+E PE DSDY+RAQEARRFMIYVH+KMMIVDDEYII+GSANINQRSM+GARD+EIAMG YQP+HL+TR PARGQIHGFRM+LWYEHLGMLD+TFL PES ECV KVN++A++YWDLYSSESLE DLPGHLLRYPIGV+ EGDVTELPG E FPDTKARVLGTKSDY+PP+LTT
Sbjct:  458 ETWNVQLFRSIDEGAAFGFPETPEDAAKAGLVSGXDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSYDWQSDDIKVEDIGALHVIPKELALKIVSKIEAGERFTVYVVVPMWPEGIPESASVQAILDWQRRTMEMMYKHIVQALNAKGIEEDPRNYLTFFCIGNREVKKSGAYEPSETPEPDSDYIRAQEARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGAYQPHHLATREPARGQIHGFRMALWYEHLGMLDETFLHPESEECVSKVNRMADKYWDLYSSESLERDLPGHLLRYPIGVASEGDVTELPGAEHFPDTKARVLGTKSDYLPPILTT 808          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA2_BRAOC (Phospholipase D alpha 2 OS=Brassica oleracea var. capitata GN=PLD2 PE=1 SV=2)

HSP 1 Score: 622.854 bits (1605), Expect = 1.240e-177
Identity = 291/351 (82.91%), Postives = 325/351 (92.59%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            D WNVQLFRSIDGGAA GFP++PE AA AGLVSGKDN+IDRSIQDAYIHAIRRAK+FIYIENQYFLGSSFAW+ADGI PE+INALHLIPKELSLKIV KIE GE+F VY+VVPMWPEG PES SVQAILDWQRRT++MMYKDV QALRA+G+ EDPRNYLTFFCLGNREVK+ GEYEPAERP+ D+DY+RAQEARRFMIYVH+KMMIVDDEYII+GSANINQRSM+GARD+EIAMGGYQP+HLS R PARGQ+HGFRMSLWYEHLGMLD+TFL P S EC++KVN+IA++YWD YSSESLEHDLPGHLLRYPI V  EG++TELPG EFFPD+KAR+LG K DY+PP+LTT
Sbjct:  462 DVWNVQLFRSIDGGAAAGFPDSPEVAAEAGLVSGKDNVIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWAADGITPEDINALHLIPKELSLKIVDKIEKGEKFRVYVVVPMWPEGIPESASVQAILDWQRRTLEMMYKDVTQALRAQGLEEDPRNYLTFFCLGNREVKKEGEYEPAERPDPDTDYMRAQEARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMSLWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEGNITELPGFEFFPDSKARILGNKVDYLPPILTT 812          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA1_ORYSJ (Phospholipase D alpha 1 OS=Oryza sativa subsp. japonica GN=PLD1 PE=1 SV=2)

HSP 1 Score: 615.92 bits (1587), Expect = 1.516e-175
Identity = 288/351 (82.05%), Postives = 327/351 (93.16%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            +TWNVQLFRSIDGGAAFGFP+TPE+AA+AGLVSGKD IIDRSIQDAYIHAIRRAKNFIYIENQYFLGSS+AW  +GIKPE+I ALHLIPKEL+LK+VSKIEAGERFTVY+VVPMWPEG PESGSVQAILDWQRRTM+MMY D+ +AL+AKGI  +P++YLTFFCLGNREVK++GEY+P E+PE D+DY RAQEARRFMIYVH KMMIVDDEYIIIGSANINQRSM+GARD+EIAMGGYQPYHL+TR PARGQIHGFRM+LWYEHLGMLDD F +PES ECV+KVN+IAE+YWD+YSS+ L+ DLPGHLL YPIGV+ +G VTELPG E+FPDT+ARVLG KSDYMPP+LT+
Sbjct:  462 ETWNVQLFRSIDGGAAFGFPDTPEEAAKAGLVSGKDQIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSYAWKPEGIKPEDIGALHLIPKELALKVVSKIEAGERFTVYVVVPMWPEGVPESGSVQAILDWQRRTMEMMYTDITEALQAKGIEANPKDYLTFFCLGNREVKQAGEYQPEEQPEADTDYSRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLECVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARVLGAKSDYMPPILTS 812          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA1_MAIZE (Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 7.524e-175
Identity = 290/351 (82.62%), Postives = 320/351 (91.17%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTRVPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            +TWNVQLFRSIDGGAAFGFPETPE+AARAGLVSGKD IIDRSIQDAY++AIRRAKNFIYIENQYFLGSS+ W  +GIKPEEI ALHLIPKELSLKIVSKIEAGERFTVY+VVPMWPEG PES SVQAILDWQRRTM+MMY D+ QAL A GI  +P++YLTFFCLGNREVK+ GEYEP E PE D+DY+RAQEARRFMIYVH KMMIVDDEYIIIGSANINQRSM+GARD+EIAMG YQPYHL+TR PARGQIHGFRMSLWYEHLGML+D F +PES ECV+KVN++AE+YWDLYSS+ LE DLPGHLL YPIGV+ +G VTELPG E FPDT+ARVLG KSDY+PP+LTT
Sbjct:  462 ETWNVQLFRSIDGGAAFGFPETPEEAARAGLVSGKDQIIDRSIQDAYVNAIRRAKNFIYIENQYFLGSSYGWKPEGIKPEEIGALHLIPKELSLKIVSKIEAGERFTVYVVVPMWPEGVPESASVQAILDWQRRTMEMMYTDIAQALEANGIEANPKDYLTFFCLGNREVKQEGEYEPEEHPEPDTDYIRAQEARRFMIYVHTKMMIVDDEYIIIGSANINQRSMDGARDSEIAMGAYQPYHLATRQPARGQIHGFRMSLWYEHLGMLEDVFQRPESVECVQKVNEVAEKYWDLYSSDDLEQDLPGHLLSYPIGVTADGSVTELPGMENFPDTRARVLGNKSDYLPPILTT 812          
BLAST of DC900406 vs. ExPASy Swiss-Prot
Match: PLDA2_ORYSJ (Phospholipase D alpha 2 OS=Oryza sativa subsp. japonica GN=PLD2 PE=2 SV=2)

HSP 1 Score: 557.755 bits (1436), Expect = 4.899e-158
Identity = 268/352 (76.14%), Postives = 309/352 (87.78%), Query Frame = 3
Query:    3 DTWNVQLFRSIDGGAAFGFPETPEDAARAGLVSGKDNIIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWSADGIKPEEINALHLIPKELSLKIVSKIEAGERFTVYIVVPMWPEGFPESGSVQAILDWQRRTMDMMYKDVVQALRAKGIMEDPRNYLTFFCLGNREVKRSGEYEPAERPEDDSDYLRAQEARRFMIYVHAKMMIVDDEYIIIGSANINQRSMEGARDTEIAMGGYQPYHLSTR-VPARGQIHGFRMSLWYEHLGMLDDTFLQPESSECVKKVNQIAERYWDLYSSESLEHDLPGHLLRYPIGVSGEGDVTELPGTEFFPDTKARVLGTKSDYMPPVLTT 1055
            + W+VQLFRSIDGGA FGFP TPE AAR+GLVSGK+N IDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAW ADGI+PE+I ALHLIP+E+SLKIV+KIEAGERF VY+V+PMWPEG P SGSVQAILDWQRRTM+MMY D+  AL AK I  DPR+YLTFFCLGNREVK +GEYEPA RP D +DY +AQ+ARRFMIYVH+KMMIVDDEYII+GSANINQRSM+G RD+EIAMG +QP HL+T+ + ARGQIHGFRMSLWYEHLGML D FL PES ECV++VN++A++YWDLY+S+ L  DLPGHLL YP+ V+ EG VTELPG +FFPDT+A V+GTK + +PP LTT
Sbjct:  467 EAWSVQLFRSIDGGACFGFPSTPEAAARSGLVSGKNNTIDRSIQDAYIHAIRRAKNFIYIENQYFLGSSFAWKADGIRPEDIEALHLIPREISLKIVNKIEAGERFAVYVVLPMWPEGPPASGSVQAILDWQRRTMEMMYYDIAVALEAKRINADPRDYLTFFCLGNREVKLNGEYEPAGRPLDGTDYAKAQKARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGGRDSEIAMGAFQPCHLNTKGLVARGQIHGFRMSLWYEHLGMLHDNFLNPESLECVQRVNKMADKYWDLYASDELNDDLPGHLLTYPVRVTKEGTVTELPGAKFFPDTQAPVIGTKGN-LPPFLTT 817          
The following BLAST results are available for this feature:
BLAST of DC900406 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 34
Match NameE-valueIdentityDescription
PLDA1_RICCO0.000e+088.32Phospholipase D alpha 1 OS=Ricinus communis GN=PLD... [more]
PLDA1_ARATH0.000e+085.47Phospholipase D alpha 1 OS=Arabidopsis thaliana GN... [more]
PLDA2_ARATH0.000e+085.23Phospholipase D alpha 2 OS=Arabidopsis thaliana GN... [more]
PLDA1_BRAOC0.000e+085.47Phospholipase D alpha 1 OS=Brassica oleracea var. ... [more]
PLDA1_VIGUN0.000e+086.04Phospholipase D alpha 1 OS=Vigna unguiculata GN=PL... [more]
PLDA1_TOBAC2.260e-17984.90Phospholipase D alpha 1 OS=Nicotiana tabacum GN=PL... [more]
PLDA2_BRAOC1.240e-17782.91Phospholipase D alpha 2 OS=Brassica oleracea var. ... [more]
PLDA1_ORYSJ1.516e-17582.05Phospholipase D alpha 1 OS=Oryza sativa subsp. jap... [more]
PLDA1_MAIZE7.524e-17582.62Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 S... [more]
PLDA2_ORYSJ4.899e-15876.14Phospholipase D alpha 2 OS=Oryza sativa subsp. jap... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900406 VSS Citrus sinensis cDNA clone VS28984 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900406 ID=DC900406|Name=DC900406|organism=Citrus sinensis|type=EST|length=1245bp
ATGACACATGGAATGTGCAATTGTTTAGATCCATTGATGGTGGGGCTGCA
TTTGGCTTCCCAGAGACGCCTGAAGATGCAGCTAGAGCTGGGCTTGTTAG
TGGGAAGGATAATATCATTGACCGCAGCATTCAGGATGCTTATATCCATG
CTATCCGGCGTGCAAAGAATTTCATCTATATTGAAAATCAGTATTTCCTT
GGAAGCTCTTTTGCTTGGAGTGCTGATGGCATTAAGCCTGAGGAAATTAA
TGCTTTGCATCTGATTCCAAAGGAGCTCTCACTTAAGATTGTTAGTAAGA
TTGAGGCTGGGGAGAGATTTACCGTATATATTGTTGTCCCAATGTGGCCA
GAGGGGTTTCCAGAGTCTGGTTCAGTTCAGGCAATATTAGATTGGCAGAG
AAGGACAATGGATATGATGTATAAGGATGTTGTTCAGGCTCTTAGAGCAA
AGGGCATTATGGAAGATCCCAGGAACTATTTGACATTCTTCTGCCTTGGG
AATCGGGAGGTGAAGAGGAGTGGTGAATATGAACCTGCAGAAAGGCCGGA
GGATGATTCAGACTATCTTAGAGCTCAGGAAGCTCGACGCTTCATGATCT
ACGTTCATGCCAAGATGATGATTGTTGATGACGAATACATTATAATTGGA
TCTGCCAACATCAACCAGCGATCAATGGAGGGTGCCAGGGACACTGAGAT
AGCCATGGGAGGCTACCAACCATATCATTTGTCAACCAGGGTGCCAGCAC
GAGGCCAGATACACGGCTTCCGTATGTCACTATGGTACGAGCACCTAGGC
ATGCTCGATGACACCTTCCTCCAGCCAGAAAGTAGCGAATGTGTTAAGAA
GGTTAACCAGATTGCCGAACGGTATTGGGACCTGTACTCCAGTGAGTCTC
TTGAGCATGACTTGCCCGGTCACTTGCTCCGCTACCCCATTGGTGTTTCT
GGTGAAGGAGATGTCACGGAGTTGCCAGGAACCGAGTTCTTCCCCGACAC
CAAGGCTCGTGTTCTCGGTACCAAATCGGATTATATGCCCCCAGTCCTGA
CCACCTGATGCTCTCCANAGGGTGCCAAAAATAATTTCGTAGTTGCGAAC
TACCGGTTATGGTAGTATAGCAAATAATAAATGATGTGTATTAAAACCAA
CAGGTGTGGTATTGTTTTTCTGCTTTGGTTCAGAGATGTGGTGTGATTTG
GTGATATACTGACGGGAAACTTATTAAGTCTGTTTATTTGTGCAT
back to top