DC900404

Overview
NameDC900404
Unique NameDC900404
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1138
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3768 contig Csv1_Contig3768:572..1707. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E137_ARATH (Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis thaliana GN=At4g34480 PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 1.417e-126
Identity = 158/197 (80.20%), Postives = 169/197 (85.79%), Query Frame = 3
Query:    6 SDPPSSGSFIR--QDTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGISK---SSQTPSAPVTPS 581
            SDPPSSGSF    Q  ++GILQFL D GSPF INPYPFFAYQSDPRPETLAFCLF+PNAGRVDS TGIKY NMFDAQVDAVHSAL +MGF+ VEIVVAETGW  RGD NEVG SV+NAKAYNGNLIAHLRSM GTPLMPGK VDTYIFALYDE+LKPGP+SER+FGLFK DLS  YDVG++K   SSQTPS  VT S
Sbjct:  166 SDPPSSGSFAAGYQTGLKGILQFLSDTGSPFAINPYPFFAYQSDPRPETLAFCLFEPNAGRVDSKTGIKYTNMFDAQVDAVHSALKSMGFEKVEIVVAETGWASRGDANEVGASVDNAKAYNGNLIAHLRSMVGTPLMPGKPVDTYIFALYDENLKPGPSSERAFGLFKTDLSMVYDVGLAKSSSSSQTPSGKVTSS 362          

HSP 2 Score: 161.77 bits (408), Expect = 1.417e-126
Identity = 71/98 (72.45%), Postives = 82/98 (83.67%), Query Frame = 2
Query:  602 TPSPKPTAAGWCVPKAGISDAQLQASLDYACSQGIDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVYPSGG 895
            TPS K T++GWCVPK G ++ +LQASLD+AC  GIDC  IQPGGACFEPN VVSHAA+AMN+Y+Q S K P +CDFSKTAT+TSQNPSYN CVYP GG
Sbjct:  354 TPSGKVTSSGWCVPKKGATNEELQASLDWACGHGIDCGAIQPGGACFEPNNVVSHAAYAMNMYFQKSPKQPTDCDFSKTATVTSQNPSYNNCVYPGGG 451          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E13B_WHEAT (Glucan endo-1,3-beta-glucosidase OS=Triticum aestivum GN=GLC1 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.663e-69
Identity = 83/196 (42.35%), Postives = 126/196 (64.29%), Query Frame = 3
Query:   15 PSSGSF---IRQDTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGISKSSQTPSAPVTPSTPKN 593
            PS+ SF           +LQF +D GSPF +NPYP+F+Y    RPETL + LF+PN+G  D  T + Y +M DAQ+DA+++A+  +G+ DV+I V E GWP + +P ++G  V+ A+ +N  +I    S  GTPLMP ++ +TY+F+L+DE+ KPGP +ER FGLF PD +  YD+G+ +   + +   +P+   N
Sbjct:  173 PSNASFRAGYNTKLFPAMLQFHRDTGSPFMVNPYPYFSY----RPETLNYALFRPNSGIYDPATKLNYTSMLDAQMDAIYTAMKKLGYGDVDIAVGEAGWPTQAEPGQIGVGVQEARDFNEGMIRVCSSGKGTPLMPNRTFETYLFSLFDENQKPGPIAERHFGLFNPDFTPVYDLGLLRDGASVAPTPSPNPSPN 364          

HSP 2 Score: 105.145 bits (261), Expect = 2.663e-69
Identity = 48/98 (48.98%), Postives = 62/98 (63.27%), Query Frame = 2
Query:  605 PSPKPTAAG---WCVPKAGISDAQLQASLDYACSQGIDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVYPS 889
            PSPKP  +G   WCV K G +   LQ +++YAC   +DC PIQ GGACF PN++ +HA++ MN YYQ +      CDF  T  +TS +PSY GC Y S
Sbjct:  365 PSPKPAPSGGGKWCVAKDGANGTDLQNNINYACGF-VDCKPIQSGGACFSPNSLQAHASYVMNAYYQANGHTDLACDFKGTGIVTSSDPSYGGCKYVS 461          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E1312_ARATH (Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis thaliana GN=At4g29360 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.078e-61
Identity = 82/196 (41.84%), Postives = 128/196 (65.31%), Query Frame = 3
Query:    3 QSDPPSSGSFIRQDT--MRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGISKSSQTPSAPVTPST 584
            +S PPSS SF ++ +  ++ +L+FL ++ SPF I+ YP++AY+       L + LF+ ++  VD  TG+ Y NMFDAQ+DA++ AL AM FK V+++V E+GWP +G P E   + ENA AYN NLI H+    GTP  PG+ +D Y+F+L++E+ KPG  SER++G+F  + +  Y +  +  + TP +P   +T
Sbjct:  165 RSFPPSSASFSKKHSAFLKPMLEFLVENESPFMIDLYPYYAYRDSTEKVPLEYALFESSSQVVDPATGLLYSNMFDAQLDAIYFALTAMSFKTVKVMVTESGWPSKGSPKETAATPENALAYNTNLIRHVIGDPGTPAKPGEEIDVYLFSLFNENRKPGIESERNWGMFYANGTNVYALDFTGENTTPVSPTNSTT 360          

HSP 2 Score: 88.5817 bits (218), Expect = 1.078e-61
Identity = 37/85 (43.53%), Postives = 55/85 (64.71%), Query Frame = 2
Query:  632 WCVPKAGISDAQLQASLDYACSQG-IDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVY 883
            WC+  +  S  +LQ +LD+AC  G +DCS +QP   CFEP+TV+SHA++A N YYQ S  +  +C F+  +    ++PSY  C+Y
Sbjct:  391 WCIASSQASVTELQTALDWACGPGNVDCSAVQPDQPCFEPDTVLSHASYAFNTYYQQSGASSIDCSFNGASVEVDKDPSYGNCLY 475          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E1313_ARATH (Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis thaliana GN=At5g56590 PE=1 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 4.025e-58
Identity = 84/204 (41.18%), Postives = 131/204 (64.22%), Query Frame = 3
Query:    3 QSDPPSSGSFIRQDT--MRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNE-VGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDV---GISKSSQTPSAPVTPSTPKNS 596
            +S PPS+G+F       +R +L+FL ++ SPF I+ YP++AY+  P   +L + LF+ ++  +D  TG+ Y NMFDAQVDA++ AL A+ F+ ++I+V ETGWP +G P E    S +NA+ YN N+I H+ +  GTP  PG++++ YIF+L++E+ K G  SER++GLF PD ++ Y +   G S    + S+    S   NS
Sbjct:  165 RSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPYYAYRDSPNNVSLDYVLFESSSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVTETGWPTKGSPKEKAAASSDNAETYNSNIIRHVVTNQGTPAKPGEAMNVYIFSLFNENRKAGLDSERNWGLFYPDQTSVYQLDFTGKSNGFHSNSSGTNSSGSSNS 368          

HSP 2 Score: 83.5741 bits (205), Expect = 4.025e-58
Identity = 37/104 (35.58%), Postives = 61/104 (58.65%), Query Frame = 2
Query:  632 WCVPKAGISDAQLQASLDYACSQG-IDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVY-PSGGT*NGQTNSQLMLNN 937
            WC+  +  S+  L+ +LD+AC  G +DC+ IQP   CF+P+T+VSHA+F  N Y+Q +      C F       +++PSY+ C+Y  +GG     TN+  + ++
Sbjct:  369 WCIASSKASERDLKGALDWACGPGNVDCTAIQPSQPCFQPDTLVSHASFVFNSYFQQNRATDVACSFGGAGVKVNKDPSYDKCIYITAGGNKTKATNATALTSS 472          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E133_ARATH (Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis thaliana GN=At2g01630 PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 5.636e-54
Identity = 77/184 (41.85%), Postives = 112/184 (60.87%), Query Frame = 3
Query:    6 SDPPSSGSFIR--QDTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQP---NAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGIS 542
            S PPS   F +     +  +L+FL+  GSP  +N YP+F Y        L + LFQP   N   VD+ T + Y N+FDA VDA + A++ + F ++ IVV E+GWP +G P+E   +VENA  YN NLI H+ +  GTP  PG +V TYI+ LY+ED +PGP SE+++GLF  + +  Y + ++
Sbjct:  162 SFPPSQAFFNKTWDPVIVPLLKFLQSTGSPLLLNVYPYFDYVQSNGVIPLDYALFQPLQANKEAVDANTLLHYTNVFDAIVDAAYFAMSYLNFTNIPIVVTESGWPSKGGPSEHDATVENANTYNSNLIQHVINKTGTPKHPGTAVTTYIYELYNEDTRPGPVSEKNWGLFYTNGTPVYTLRLA 345          

HSP 2 Score: 85.8853 bits (211), Expect = 5.636e-54
Identity = 38/92 (41.30%), Postives = 56/92 (60.87%), Query Frame = 2
Query:  632 WCVPKAGISDAQLQASLDYACSQG-IDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVYPSGGT*N 904
            +C+ K  +    LQA+LD+AC  G +DCS +  G +C+EP+ VV+H+ +A N YYQ   K   +CDF   AT+T+ +PS   CV+P     N
Sbjct:  360 FCIAKEKVDRKMLQAALDWACGPGKVDCSALMQGESCYEPDDVVAHSTYAFNAYYQKMGKASGSCDFKGVATVTTTDPSRGTCVFPGSAKSN 451          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E131_ARATH (Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis thaliana GN=At1g11820 PE=1 SV=2)

HSP 1 Score: 130.568 bits (327), Expect = 1.743e-49
Identity = 70/184 (38.04%), Postives = 102/184 (55.43%), Query Frame = 3
Query:   12 PPSSGSFIR--QDTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQP---NAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGISKS 548
            PPS   F +     M  +LQFL   GSP  +N YP++ Y  +     L  CLF+P   +   VD  T + Y N+ DA VDA + ++  +   DV ++V E+GWP +GD  E   +++NA  YN NLI H+    GTPL P  +   YI+ L++EDL+  P SE S+GLF  + +  Y + +S S
Sbjct:   76 PPSQAYFNQTWHSIMVPLLQFLSKTGSPLMMNLYPYYVYMQNKGVVPLDNCLFEPLTPSKEMVDPNTLLHYTNVLDAMVDAAYVSMKNLNVSDVAVLVTESGWPSKGDSKEPYATIDNADTYNSNLIKHVFDRTGTPLHPEMTSSVYIYELFNEDLRAPPVSEASWGLFYGNSTPVYLLHVSGS 259          

HSP 2 Score: 87.8113 bits (216), Expect = 1.743e-49
Identity = 37/86 (43.02%), Postives = 55/86 (63.95%), Query Frame = 2
Query:  632 WCVPKAGISDAQLQASLDYACSQG-IDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVYP 886
            +C+   G+    LQA+LD+AC  G  +CS IQPG +C++PN V  HA+FA N YYQ   +   +CDF   A +T+ +PS+  C++P
Sbjct:  272 YCIAMDGVDAKTLQAALDWACGPGRSNCSEIQPGESCYQPNNVKGHASFAFNSYYQKEGRASGSCDFKGVAMITTTDPSHGSCIFP 357          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E132_ARATH (Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis thaliana GN=At1g66250 PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 5.020e-49
Identity = 71/196 (36.22%), Postives = 107/196 (54.59%), Query Frame = 3
Query:   12 PPSSGSFIRQ--DTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQP---NAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGISKSSQTPSAPVTPST 584
            PPS   F R     +  +L FL+   S   +N YP+  Y        L + LF+P   N   VD+ T ++Y N FDA VDA + A+  + F ++ ++V E+GWP +G+ NE   +++NA  YN NLI H+ +  GTP  PG +V TYI+ LY+ED K G  SE+++GLF  +    Y + ++ S    +   T  T
Sbjct:  173 PPSQAFFNRSLNAVIVPLLSFLQSTNSYLMVNVYPYIDYMQSNGVIPLDYALFKPIPPNKEAVDANTLVRYSNAFDAMVDATYFAMAFLNFTNIPVLVTESGWPSKGETNEPDATLDNANTYNSNLIRHVLNKTGTPKRPGIAVSTYIYELYNEDTKAG-LSEKNWGLFNANGEPVYVLRLTNSGSVLANDTTNQT 367          

HSP 2 Score: 87.8113 bits (216), Expect = 5.020e-49
Identity = 40/99 (40.40%), Postives = 63/99 (63.64%), Query Frame = 2
Query:  632 WCVPKAGISDAQLQASLDYACSQG-IDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVYPSGGT*NGQTNSQL 925
            +C  + G     LQA+LD+AC  G IDCSPI+ G  C+EP+ VV+HA +A + YY  +  NP  C+F+  A++T+ +PS+  CV+ +G   NG+  + +
Sbjct:  368 YCTAREGADTKMLQAALDWACGPGKIDCSPIKQGETCYEPDNVVAHANYAFDTYYHQTGNNPDACNFNGVASITTTDPSHGTCVF-AGSRGNGRNGTSV 465          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E134_ARATH (Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis thaliana GN=At3g13560 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 3.208e-48
Identity = 70/187 (37.43%), Postives = 110/187 (58.82%), Query Frame = 3
Query:   12 PPSSGSFIRQ--DTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQ---PNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGISKSSQT 557
            PPS+ +F      T+  +LQFLK+ GS F +N YP++ Y +      L + LF+   P    VD  T + Y +MFDA VDA + ++ A+ F  + +VV ETGWP  G  +E   +V NA+ +N NLI  + + +G P  P   ++TYI+ LY+ED + GP SER++G+  P+ ++ Y + +S  S +
Sbjct:  167 PPSTSTFSPSWNTTVYQLLQFLKNTGSFFMLNAYPYYGYTTANGIFPLDYALFKQLSPVKQIVDPNTLLHYNSMFDAMVDAAYYSMEALNFSKIPVVVTETGWPSSGGSDEAAATVANAETFNTNLIKRVLNNSGPPSQPDIPINTYIYELYNEDKRSGPVSERNWGILFPNGTSVYPLSLSGGSSS 353          

HSP 2 Score: 81.6481 bits (200), Expect = 3.208e-48
Identity = 40/85 (47.06%), Postives = 51/85 (60.00%), Query Frame = 2
Query:  632 WCVPKAGISDAQLQASLDYACSQG-IDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKNPWNCDFSKTATLTSQNPSYNGCVY 883
            +CV KA   D +L   L++AC QG  +C+ IQPG  C+ PN V SHA+FA N YYQ        CDF  TA  T+++PSY  C Y
Sbjct:  362 FCVAKADADDDKLVDGLNWACGQGRANCAAIQPGQPCYLPNDVKSHASFAFNDYYQKMKSAGGTCDFDGTAITTTRDPSYRTCAY 446          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E1311_ARATH (Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis thaliana GN=At1g32860 PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 6.248e-48
Identity = 97/183 (53.01%), Postives = 125/183 (68.31%), Query Frame = 3
Query:    6 SDPPSSGSFIRQ--DTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRS--MAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGIS 542
            S PPS+G F     D++  IL+F +   SPF IN YPFFAY+ +P+   L F LFQPN G VD  TG  Y NM  AQ+DAV+SAL A GFK + + ++ETGWP +GD +EVG + ENAK YNGNLI  + S     TPL P   +  Y+FAL++E+LKPGPTSER++GLFKPD + AY +G +
Sbjct:  168 SFPPSAGEFQPDLLDSLTPILEFHRKTDSPFLINAYPFFAYKGNPKEVPLDFVLFQPNQGIVDPATGFHYDNMLFAQIDAVYSALAAAGFKSLRVEISETGWPSKGDDDEVGATPENAKRYNGNLIKMMMSGKKTKTPLKPNNDLSIYVFALFNENLKPGPTSERNYGLFKPDGTQAYSLGFA 350          
BLAST of DC900404 vs. ExPASy Swiss-Prot
Match: E1314_ARATH (Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis thaliana GN=At2g27500/F10A12.18 PE=1 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 4.478e-46
Identity = 89/180 (49.44%), Postives = 119/180 (66.11%), Query Frame = 3
Query:    6 SDPPSSGSFIRQ--DTMRGILQFLKDHGSPFTINPYPFFAYQSDPRPETLAFCLFQPNAGRVDSGTGIKYMNMFDAQVDAVHSALNAMGFKDVEIVVAETGWPYRGDPNEVGPSVENAKAYNGNLIAHLRSMAGTPLMPGKSVDTYIFALYDEDLKPGPTSERSFGLFKPDLSAAYDVGI 539
            S PPSSGSF  +    ++ +L F     SPF IN YPFFAY+  P+   L + LFQPN G VD  T + Y NM  AQVDA++SA+  +G  D+E+ ++ETGWP +GD NE+G S ENA  YNGNL+  ++   GTP      +D Y+FAL++E+LKPGP SER++GLF PD    Y+VG+
Sbjct:  169 SYPPSSGSFKEEFIQYLQPLLDFHSQIESPFLINAYPFFAYKDSPKEVPLEYVLFQPNQGMVDPNTNLHYDNMLFAQVDALYSAIKTLGHTDIEVRISETGWPSKGDENEIGASPENAALYNGNLLKLIQQRKGTPAKQSVPIDVYVFALFNENLKPGPVSERNYGLFYPDGKPVYNVGM 348          
The following BLAST results are available for this feature:
BLAST of DC900404 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
E137_ARATH1.417e-12680.20Glucan endo-1,3-beta-glucosidase 7 OS=Arabidopsis ... [more]
E13B_WHEAT2.663e-6942.35Glucan endo-1,3-beta-glucosidase OS=Triticum aesti... [more]
E1312_ARATH1.078e-6141.84Glucan endo-1,3-beta-glucosidase 12 OS=Arabidopsis... [more]
E1313_ARATH4.025e-5841.18Glucan endo-1,3-beta-glucosidase 13 OS=Arabidopsis... [more]
E133_ARATH5.636e-5441.85Glucan endo-1,3-beta-glucosidase 3 OS=Arabidopsis ... [more]
E131_ARATH1.743e-4938.04Glucan endo-1,3-beta-glucosidase 1 OS=Arabidopsis ... [more]
E132_ARATH5.020e-4936.22Glucan endo-1,3-beta-glucosidase 2 OS=Arabidopsis ... [more]
E134_ARATH3.208e-4837.43Glucan endo-1,3-beta-glucosidase 4 OS=Arabidopsis ... [more]
E1311_ARATH6.248e-4853.01Glucan endo-1,3-beta-glucosidase 11 OS=Arabidopsis... [more]
E1314_ARATH4.478e-4649.44Glucan endo-1,3-beta-glucosidase 14 OS=Arabidopsis... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900404 VSS Citrus sinensis cDNA clone VS28980 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900404 ID=DC900404|Name=DC900404|organism=Citrus sinensis|type=EST|length=1138bp
CACAATCCGACCCGCCGTCCTCCGGGTCATTCATCCGCCAAGACACTATG
AGAGGGATTTTGCAGTTTCTTAAAGACCACGGCTCCCCTTTTACCATCAA
CCCGTACCCGTTTTTCGCTTATCAAAGTGACCCGAGACCCGAGACTCTTG
CCTTCTGTTTGTTTCAACCCAACGCGGGACGAGTTGACTCCGGGACCGGG
ATCAAATACATGAACATGTTCGACGCCCAGGTTGATGCTGTACATTCAGC
CTTGAATGCAATGGGGTTCAAGGATGTCGAGATTGTGGTTGCAGAGACAG
GGTGGCCTTACCGCGGAGACCCGAATGAGGTTGGACCTAGTGTTGAGAAT
GCCAAGGCCTATAACGGGAACTTGATTGCTCACCTTAGATCAATGGCTGG
AACTCCATTGATGCCTGGAAAATCTGTGGATACATATATTTTTGCTCTCT
ATGATGAGGACTTGAAGCCTGGCCCTACCTCTGAACGTTCATTCGGGCTC
TTCAAGCCAGACCTTTCAGCAGCATATGATGTTGGTATTTCAAAGAGTAG
CCAGACTCCATCAGCTCCAGTGACTCCATCAACTCCAAAAAACTCCAAAC
GACTCCATCACCAAAACCAACAGCAGCTGGTTGGTGTGTGCCCAAGGCCG
GCATCTCCGATGCACAACTGCAGGCAAGTCTTGACTATGCCTGCAGCCAA
GGCATCGATTGCAGTCCTATCCAGCCAGGAGGTGCCTGTTTTGAACCAAA
TACAGTAGTATCACATGCTGCTTTTGCCATGAATCTCTACTACCAGACTT
CTGCAAAAAATCCATGGAACTGCGACTTCTCAAAAACGGCAACACTCACA
TCCCAAAATCCCAGTTACAATGGATGTGTCTATCCTAGTGGGGGTACTTG
AAATGGCCAGACGAATTCCCAGTTGATGTTGAATAATGGAATGTTAAGTG
AAATAAAAGTGATGAATCTAATGGTTCCTATTTTATAGATAGCTTTAATT
GTAAAGGTTTCCTCCTCTGATTAAAATGTATCGAGGAAACTCTTTCTTTT
CTTCTCTTTTTTCTTATTTATTAAAATTATTTGTATCCCTATATTGAGAA
TAACATTAGTGGTTNAAATAAACTGTTTGAATATATTC
back to top