DC900401

Overview
NameDC900401
Unique NameDC900401
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length576
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3965 contig Csv1_Contig3965:981..1554. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME3_CITSI (Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.575e-78
Identity = 96/122 (78.69%), Postives = 107/122 (87.70%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLYVHS RQF+ +C+IAGTVDFIFGNAAAV QNCDIHAR+PN  Q+NMVTAQGR DPNQNTGIVIQK RIGATSDL  V+GSF TYLGRPWK YSRTV+MQS I+DVI+PAGW+EW G F +
Sbjct:  402 TLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKPNSGQKNMVTAQGRADPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDVIHPAGWHEWDGNFAL 523          

HSP 2 Score: 107.457 bits (267), Expect = 1.575e-78
Identity = 50/66 (75.76%), Postives = 56/66 (84.85%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            GNFAL+TLFY E+QN GAGA TS RVKW  F+VITSA EAQ +T  +FIAGS+WLGSTGFPFSLGL
Sbjct:  519 GNFALNTLFYGEHQNAGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL 584          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME1_CITSI (Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.054e-78
Identity = 95/122 (77.87%), Postives = 107/122 (87.70%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLYVHS RQF+ +C+IAGTVDFIFGNAAAV QNCDIHAR+PN  Q+NMVTAQGR DPNQNTGIVIQK RIGATSDL  V+GSF TYLGRPWK YSRTV+MQS I+D+I+PAGW+EW G F +
Sbjct:  402 TLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQNCDIHARKPNSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLKPVQGSFPTYLGRPWKEYSRTVIMQSSITDLIHPAGWHEWDGNFAL 523          

HSP 2 Score: 107.842 bits (268), Expect = 2.054e-78
Identity = 50/66 (75.76%), Postives = 57/66 (86.36%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            GNFAL+TLFY E+QN+GAGA TS RVKW  F+VITSA EAQ +T  +FIAGS+WLGSTGFPFSLGL
Sbjct:  519 GNFALNTLFYGEHQNSGAGAGTSGRVKWKGFRVITSATEAQAFTPGSFIAGSSWLGSTGFPFSLGL 584          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PMEU1_SOLLC (Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum GN=PMEU1 PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 2.243e-77
Identity = 94/122 (77.05%), Postives = 105/122 (86.07%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLYVHS RQF+  C++AGTVDFIFGN AAVFQ+CDIHARRP   Q+NMVTAQGR DPNQNTGIVIQKCRIGATSDL  V+ SF TYLGRPWK YSRTV+MQS I+DVI PAGW+EW+G F +
Sbjct:  401 TLYVHSNRQFFVQCLVAGTVDFIFGNGAAVFQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKCRIGATSDLRPVQKSFPTYLGRPWKEYSRTVIMQSSITDVIQPAGWHEWNGNFAL 522          

HSP 2 Score: 105.531 bits (262), Expect = 2.243e-77
Identity = 50/66 (75.76%), Postives = 52/66 (78.79%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            GNFALDTLFY EY NTGAGA TS RVKW   KVITS+ EAQ YT   FIAG +WL STGFPFSLGL
Sbjct:  518 GNFALDTLFYGEYANTGAGAPTSGRVKWKGHKVITSSTEAQAYTPGRFIAGGSWLSSTGFPFSLGL 583          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME2_ARATH (Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 PE=2 SV=2)

HSP 1 Score: 209.149 bits (531), Expect = 2.239e-74
Identity = 97/122 (79.51%), Postives = 105/122 (86.07%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLYVHS RQF+  C I GTVDFIFGNAAAV Q+CDI+ARRPN  Q+NMVTAQGR DPNQNTGIVIQ CRIG TSDLLAVKG+F TYLGRPWK YSRTV+MQSDISDVI P GW+EWSG F +
Sbjct:  405 TLYVHSNRQFFVKCHITGTVDFIFGNAAAVLQDCDINARRPNSGQKNMVTAQGRSDPNQNTGIVIQNCRIGGTSDLLAVKGTFPTYLGRPWKEYSRTVIMQSDISDVIRPEGWHEWSGSFAL 526          

HSP 2 Score: 92.4337 bits (228), Expect = 2.239e-74
Identity = 44/66 (66.67%), Postives = 48/66 (72.73%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            G+FALDTL Y EY N G GA T+NRVKW  +KVITS  EAQ +TA  FI G  WL STGFPFSL L
Sbjct:  522 GSFALDTLTYREYLNRGGGAGTANRVKWKGYKVITSDTEAQPFTAGQFIGGGGWLASTGFPFSLSL 587          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME_DAUCA (Pectinesterase OS=Daucus carota PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 5.448e-73
Identity = 92/122 (75.41%), Postives = 102/122 (83.61%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            +LYVHS RQF+ +C IAGTVDFIFGNAA V Q+CDIHARRP   Q+NMVTAQGR DPNQNTGIVIQK RIGATSDL  V+ SF TYLGRPWK YSRTVVMQS I++VINPAGW+ W G F +
Sbjct:  137 SLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSGQKNMVTAQGRTDPNQNTGIVIQKSRIGATSDLQPVQSSFPTYLGRPWKEYSRTVVMQSSITNVINPAGWFPWDGNFAL 258          

HSP 2 Score: 99.7525 bits (247), Expect = 5.448e-73
Identity = 47/66 (71.21%), Postives = 53/66 (80.30%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            GNFALDTL+Y EYQNTGAGA TS RV W  FKVITS+ EAQ +T  +FIAG +WL +T FPFSLGL
Sbjct:  254 GNFALDTLYYGEYQNTGAGAATSGRVTWKGFKVITSSTEAQGFTPGSFIAGGSWLKATTFPFSLGL 319          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME18_ARATH (Pectinesterase/pectinesterase inhibitor 18 OS=Arabidopsis thaliana GN=PME18 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 1.279e-59
Identity = 82/122 (67.21%), Postives = 96/122 (78.69%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLY H+LRQFY    I GTVDFIFGN+A VFQNCDI AR P   Q+NM+TAQGR+D NQNT I IQKC+I A+SDL  VKGS +T+LGRPWK YSRTV+MQS I + I+PAGW+ W GEF +
Sbjct:  375 TLYTHTLRQFYRDSYITGTVDFIFGNSAVVFQNCDIVARNPGAGQKNMLTAQGREDQNQNTAISIQKCKITASSDLAPVKGSVKTFLGRPWKLYSRTVIMQSFIDNHIDPAGWFPWDGEFAL 496          

HSP 2 Score: 75.485 bits (184), Expect = 1.279e-59
Identity = 35/62 (56.45%), Postives = 39/62 (62.90%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPF 562
            G FAL TL+Y EY NTG GADTS RV W  FKVI  + EA+ +T A  I G  WL  TG  F
Sbjct:  492 GEFALSTLYYGEYANTGPGADTSKRVNWKGFKVIKDSKEAEQFTVAKLIQGGLWLKPTGVTF 553          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME36_ARATH (Probable pectinesterase/pectinesterase inhibitor 36 OS=Arabidopsis thaliana GN=PME36 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 8.096e-56
Identity = 76/122 (62.30%), Postives = 95/122 (77.87%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TL+ HSLRQFY    I GT+DFIFG+AAAVFQNCDI  RRP  +Q NM+TAQGRDDP+ N+GI IQ  RI A  +  AVKG F++YLGRPWK+YSRTV +++DI ++I+P GW EWSG + +
Sbjct:  337 TLFTHSLRQFYRDRHIYGTIDFIFGDAAAVFQNCDIFVRRPMDHQGNMITAQGRDDPHTNSGISIQHSRIRAAPEFEAVKGRFKSYLGRPWKKYSRTVFLKTDIDELIDPRGWREWSGSYAL 458          

HSP 2 Score: 73.9442 bits (180), Expect = 8.096e-56
Identity = 32/66 (48.48%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            G++AL TL+Y E+ NTGAGA T  RV W  F V+    EA  +T + FI G +W+  TG PFS G+
Sbjct:  454 GSYALSTLYYGEFMNTGAGAGTGRRVNWPGFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSAGV 519          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME1_FICAW (Pectinesterase/pectinesterase inhibitor OS=Ficus awkeotsang PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.752e-55
Identity = 76/122 (62.30%), Postives = 91/122 (74.59%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLY H+ RQFY    I GTVDFIFGNAA VFQNC++  R+    Q N +TAQGR DPNQNTG  IQ C I A++DL  V+ +F++YLGRPWK YSRTVVM+S ISDVI+PAGW EW  +F +
Sbjct:  361 TLYPHNYRQFYRDRNITGTVDFIFGNAAVVFQNCNLIPRKQMKGQENTITAQGRTDPNQNTGTSIQNCEIFASADLEPVEDTFKSYLGRPWKEYSRTVVMESYISDVIDPAGWLEWDRDFAL 482          

HSP 2 Score: 75.485 bits (184), Expect = 6.752e-55
Identity = 35/65 (53.85%), Postives = 44/65 (67.69%), Query Frame = 2
Query:  380 NFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            +FAL TLFY EY+N G G+ TS RVKW  + VITS   A+ +T A  I G +WLGSTG  ++ GL
Sbjct:  479 DFALKTLFYGEYRNGGPGSGTSERVKWPGYHVITSPEVAEQFTVAELIQGGSWLGSTGVDYTAGL 543          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME20_ARATH (Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana GN=PME20 PE=2 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 1.147e-54
Identity = 72/122 (59.02%), Postives = 84/122 (68.85%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLY HSLRQFY  C + GTVDFIFGNAA V QNC+++ R+P   Q N VTAQGR DPNQNTG  I  C I    DL     + +TYLGRPWK YSRTVVMQ+ I   + P+GW  WSG+F +
Sbjct:  377 TLYTHSLRQFYRECDVYGTVDFIFGNAAVVLQNCNLYPRQPRKGQSNEVTAQGRTDPNQNTGTAIHGCTIRPADDLATSNYTVKTYLGRPWKEYSRTVVMQTYIDGFLEPSGWNAWSGDFAL 498          

HSP 2 Score: 79.337 bits (194), Expect = 1.147e-54
Identity = 36/66 (54.55%), Postives = 46/66 (69.70%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            G+FAL TL+YAEY NTG G+DT+NRV W  + VI +A +A  +T  NF+ G  W+G TG PF  GL
Sbjct:  494 GDFALSTLYYAEYNNTGPGSDTTNRVTWPGYHVI-NATDASNFTVTNFLVGEGWIGQTGVPFVGGL 558          
BLAST of DC900401 vs. ExPASy Swiss-Prot
Match: PME1_SOLLC (Pectinesterase 1 OS=Solanum lycopersicum GN=PME1.9 PE=1 SV=5)

HSP 1 Score: 162.925 bits (411), Expect = 1.950e-54
Identity = 78/122 (63.93%), Postives = 88/122 (72.13%), Query Frame = 1
Query:   25 TLYVHSLRQFYTSCIIAGTVDFIFGNAAAVFQNCDIHARRPNPNQRNMVTAQGRDDPNQNTGIVIQKCRIGATSDLLAVKGSFETYLGRPWKRYSRTVVMQSDISDVINPAGWYEWSGEFCI 390
            TLY HS RQFY    + GTVDFIFGNAA VFQ C + AR+P   Q+NMVTAQGR DPNQ TG  IQ C I A+SDL  V   F TYLGRPWK YSRTVVM+S +  +INPAGW EW G+F +
Sbjct:  362 TLYAHSQRQFYRDSYVTGTVDFIFGNAAVVFQKCQLVARKPGKYQQNMVTAQGRTDPNQATGTSIQFCNIIASSDLEPVLKEFPTYLGRPWKEYSRTVVMESYLGGLINPAGWAEWDGDFAL 483          

HSP 2 Score: 72.0182 bits (175), Expect = 1.950e-54
Identity = 34/66 (51.52%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  377 GNFALDTLFYAEYQNTGAGADTSNRVKWSTFKVITSAAEAQTYTAANFIAGSTWLGSTGFPFSLGL 574
            G+FAL TL+Y E+ N G GA TS RVKW  + VIT  A+A  +T A  I G +WL STG  +  GL
Sbjct:  479 GDFALKTLYYGEFMNNGPGAGTSKRVKWPGYHVITDPAKAMPFTVAKLIQGGSWLRSTGVAYVDGL 544          
The following BLAST results are available for this feature:
BLAST of DC900401 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
PME3_CITSI1.575e-7878.69Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1[more]
PME1_CITSI2.054e-7877.87Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE... [more]
PMEU1_SOLLC2.243e-7777.05Pectinesterase/pectinesterase inhibitor U1 OS=Sola... [more]
PME2_ARATH2.239e-7479.51Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 P... [more]
PME_DAUCA5.448e-7375.41Pectinesterase OS=Daucus carota PE=1 SV=1[more]
PME18_ARATH1.279e-5967.21Pectinesterase/pectinesterase inhibitor 18 OS=Arab... [more]
PME36_ARATH8.096e-5662.30Probable pectinesterase/pectinesterase inhibitor 3... [more]
PME1_FICAW6.752e-5562.30Pectinesterase/pectinesterase inhibitor OS=Ficus a... [more]
PME20_ARATH1.147e-5459.02Probable pectinesterase/pectinesterase inhibitor 2... [more]
PME1_SOLLC1.950e-5463.93Pectinesterase 1 OS=Solanum lycopersicum GN=PME1.9... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900401 VSS Citrus sinensis cDNA clone VS28976 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900401 ID=DC900401|Name=DC900401|organism=Citrus sinensis|type=EST|length=576bp
GTGACATGCTAGCATACCAAGNACACTCTCTATGTACACTCACTTCGCCA
ATTTTATACCAGCTGCATTATAGCAGGCACAGTGGACTTCATTTTCGGAA
ATGCAGCAGCTGTGTTCCAAAACTGTGACATCCATGCTCGCCGCCCCAAT
CCAAACCAAAGGAACATGGTCACGGCACAAGGCCGCGACGACCCGAATCA
GAACACAGGCATAGTGATACAAAAATGCAGGATTGGTGCAACATCAGATT
TACTTGCTGTAAAGGGCAGCTTTGAGACATATTTAGGCAGGCCATGGAAG
CGGTACTCGAGGACTGTTGTGATGCAATCTGATATAAGTGATGTTATTAA
CCCAGCTGGGTGGTATGAATGGAGTGGGGAATTTTGCATTGGACACATTG
TTTTATGCAGAGTATCAAAACACAGGTGCTGGTGCTGACACATCGAATAG
GGTGAAATGGAGCACATTCAAGGTGATTACTAGTGCAGCTGAGGCTCAAA
CTTATACAGCTGCGAATTTTATTGCAGGGAGTACTTGGCTTGGCTCCACT
GGGTTTCCTTTCTCTCTTGGTCTGTG
back to top