DC900399

Overview
NameDC900399
Unique NameDC900399
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length998
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8852 contig Csv1_Contig8852:125..1116. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP11_ORYSJ (Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica GN=PIP1-1 PE=2 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 3.782e-131
Identity = 233/275 (84.73%), Postives = 254/275 (92.36%), Query Frame = 1
Query:    1 ERQPIGTSAQS---DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGT+AQ    DKDYKEPPPAPLFEPGELKSWSFYRAGIAEF+ATFLFLYIT+LTVMGVSKS++KC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRA+FY+VMQCLGA+CGAGVVKGF+    Y   GGGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+NKDHAW     +  + PF+GAALAA+YHQ++IRAIPFKSR+
Sbjct:   17 ERQPIGTAAQGAGDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMGVSKSSSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIVMQCLGAICGAGVVKGFQQGL-YMGNGGGANVVASGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHAWN-DHWIFWVGPFVGAALAAIYHQVIIRAIPFKSRS 289          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP12_ORYSJ (Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica GN=PIP1-2 PE=2 SV=3)

HSP 1 Score: 467.618 bits (1202), Expect = 4.939e-131
Identity = 235/274 (85.77%), Postives = 252/274 (91.97%), Query Frame = 1
Query:    1 ERQPIGTSAQS--DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGT+AQ   DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGV+ S +KC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRA+FYMVMQCLGA+CGAGVVKGF+    YE  GGGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+N+ HAW     +  + PFIGAALAA+YHQ+VIRAIPFKSR+
Sbjct:   17 ERQPIGTAAQGSDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVNNSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYMVMQCLGAICGAGVVKGFQKGL-YETTGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRGHAWD-DHWIFWVGPFIGAALAAIYHQVVIRAIPFKSRS 288          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP12_ARATH (Aquaporin PIP1-2 OS=Arabidopsis thaliana GN=PIP1-2 PE=1 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 4.939e-131
Identity = 235/272 (86.40%), Postives = 251/272 (92.28%), Query Frame = 1
Query:    1 ERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGTSAQSDKDYKEPPPAPLFEPGEL SWSF+RAGIAEF+ATFLFLYITVLTVMGV +S   C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRAV+Y+VMQCLGA+CGAGVVKGF+  K Y+ LGGGAN +AHGYTKG GLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKD+AW     +  + PFIGAALAA+YH IVIRAIPFKSR+
Sbjct:   17 ERQPIGTSAQSDKDYKEPPPAPLFEPGELASWSFWRAGIAEFIATFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVYYIVMQCLGAICGAGVVKGFQ-PKQYQALGGGANTIAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDNAWD-DHWVFWVGPFIGAALAALYHVIVIRAIPFKSRS 286          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP13_ARATH (Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3 PE=1 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 6.451e-131
Identity = 233/272 (85.66%), Postives = 251/272 (92.28%), Query Frame = 1
Query:    1 ERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGTSAQ+DKDYKEPPPAP FEPGEL SWSFYRAGIAEF+ATFLFLYITVLTVMGV ++   C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRAVFY+VMQCLGA+CGAGVVKGF+ +  Y+ LGGGAN VAHGYTKG GLGAEIIGTFVLVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+NKDHAW     +  + PFIGAALAA+YHQ+VIRAIPFKSR+
Sbjct:   17 ERQPIGTSAQTDKDYKEPPPAPFFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYIVMQCLGAICGAGVVKGFQPNP-YQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHAWD-DHWIFWVGPFIGAALAALYHQLVIRAIPFKSRS 286          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP12_MAIZE (Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 1.877e-130
Identity = 233/275 (84.73%), Postives = 253/275 (92.00%), Query Frame = 1
Query:    1 ERQPIGTSAQS---DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGT+AQ    DKDYKEPPPAPLFEPGELKSWSFYRAGIAEF+ATFLFLYIT+LTVMGVSKS +KC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRA+FY++MQCLGAVCGAGVVKGF+    Y   GGGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+N+DHAW     +  + PFIGAALAA+YHQ++IRAIPFKSR+
Sbjct:   17 ERQPIGTAAQGAADDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITILTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALFYIIMQCLGAVCGAGVVKGFQQGL-YMGNGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWN-DHWIFWVGPFIGAALAAIYHQVIIRAIPFKSRS 289          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP11_VICFA (Aquaporin PIP1.1 OS=Vicia faba GN=PIP1.1 PE=2 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 1.877e-130
Identity = 232/272 (85.29%), Postives = 250/272 (91.91%), Query Frame = 1
Query:    1 ERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGTSAQSDKDYKEPPPAP FEPGEL SWSF+RAGIAEF+ATFLFLYITVLTVMGV +S   C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRA++Y+VMQCLGA+CGAGVVKGF+  K Y+ LGGGAN VAHGYTKG GLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+NKDH+W     +  + PFIGAALAA+YH +VIRAIPFKSR+
Sbjct:   17 ERQPIGTSAQSDKDYKEPPPAPFFEPGELSSWSFWRAGIAEFIATFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQ-PKQYQALGGGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHSWD-DHWVFWVGPFIGAALAALYHVVVIRAIPFKSRS 286          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP11_ARATH (Aquaporin PIP1-1 OS=Arabidopsis thaliana GN=PIP1-1 PE=1 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 1.877e-130
Identity = 232/272 (85.29%), Postives = 250/272 (91.91%), Query Frame = 1
Query:    1 ERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGTSAQSDKDYKEPPPAP FEPGEL SWSF+RAGIAEF+ATFLFLYITVLTVMGV +S   C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRA++Y+VMQCLGA+CGAGVVKGF+  K Y+ LGGGAN VAHGYTKG GLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+NKDH+W     +  + PFIGAALAA+YH +VIRAIPFKSR+
Sbjct:   17 ERQPIGTSAQSDKDYKEPPPAPFFEPGELSSWSFWRAGIAEFIATFLFLYITVLTVMGVKRSPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRALYYIVMQCLGAICGAGVVKGFQ-PKQYQALGGGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHSWD-DHWVFWVGPFIGAALAALYHVVVIRAIPFKSRS 286          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP13_MAIZE (Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 2.451e-130
Identity = 233/278 (83.81%), Postives = 253/278 (91.01%), Query Frame = 1
Query:    1 ERQPIGTSAQS------DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGT+AQ       DKDYKEPPPAPLFEPGELKSWSFYRAGIAEF+ATFLFLYITVLTVMGVSKS +KC+TVGIQGIAW+FGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRA+FY++MQCLGA+CGAGVVKGF+    Y   GGGANVVA GYTKGDGLGAEI+GTF+LVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+N+DHAW     +  + PFIGAALAA+YHQ++IRAIPFKSR+
Sbjct:   17 ERQPIGTAAQGAGAGDDDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFVATFLFLYITVLTVMGVSKSTSKCATVGIQGIAWSFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAIFYIIMQCLGAICGAGVVKGFQQGL-YMGNGGGANVVAPGYTKGDGLGAEIVGTFILVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNRDHAWS-DHWIFWVGPFIGAALAAIYHQVIIRAIPFKSRS 292          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP14_ARATH (Probable aquaporin PIP1-4 OS=Arabidopsis thaliana GN=PIP1.4 PE=1 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 3.202e-130
Identity = 234/273 (85.71%), Postives = 252/273 (92.31%), Query Frame = 1
Query:    1 ERQPIGTSAQS-DKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPFKSRA 816
            ERQPIGTSAQS DKDYKEPPPAPLFEPGEL SWSFYRAGIAEF+ATFLFLYITVLTVMGV ++   C++VGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRAVFYM+MQCLGA+CGAGVVKGF+ +  Y+ LGGGAN VAHGYTKG GLGAEIIGTFVLVYTVFSATDAKR+ARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+NKDH+W     +  + PFIGAALAA+YHQIVIRAIPFKS++
Sbjct:   17 ERQPIGTSAQSTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYITVLTVMGVKRAPNMCASVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMIMQCLGAICGAGVVKGFQPTP-YQTLGGGANTVAHGYTKGSGLGAEIIGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKDHSWD-DHWIFWVGPFIGAALAALYHQIVIRAIPFKSKS 287          
BLAST of DC900399 vs. ExPASy Swiss-Prot
Match: PIP1_SOLLC (Probable aquaporin PIP-type pTOM75 OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 457.218 bits (1175), Expect = 6.676e-128
Identity = 227/268 (84.70%), Postives = 246/268 (91.79%), Query Frame = 1
Query:    1 ERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIFNKDHAWG*PLDLSGLDPFIGAALAAVYHQIVIRAIPF 804
            E QP+GT+AQ+DKDYKEPPPAPLFEPGEL SWSFYRAGIAEFMATFLFLYIT+LTVMG+ +S++ CS+VGIQG+AWAFGGMIFALVYCTAGISGGHINPAVTFGL LARKLSLTRAVFYMVMQCLGA+CGAGVVKGF     Y+RLGGGANVV  GYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAII+N +HAW     +  + P IGAALAA+YHQI+IRA+PF
Sbjct:   18 ETQPLGTAAQTDKDYKEPPPAPLFEPGELSSWSFYRAGIAEFMATFLFLYITILTVMGLKRSDSLCSSVGIQGVAWAFGGMIFALVYCTAGISGGHINPAVTFGLFLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMVGP-YQRLGGGANVVNPGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNDEHAWN-DHWIFWVGPMIGAALAAIYHQIIIRAMPF 283          
The following BLAST results are available for this feature:
BLAST of DC900399 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 195
Match NameE-valueIdentityDescription
PIP11_ORYSJ3.782e-13184.73Aquaporin PIP1-1 OS=Oryza sativa subsp. japonica G... [more]
PIP12_ORYSJ4.939e-13185.77Probable aquaporin PIP1-2 OS=Oryza sativa subsp. j... [more]
PIP12_ARATH4.939e-13186.40Aquaporin PIP1-2 OS=Arabidopsis thaliana GN=PIP1-2... [more]
PIP13_ARATH6.451e-13185.66Aquaporin PIP1-3 OS=Arabidopsis thaliana GN=PIP1-3... [more]
PIP12_MAIZE1.877e-13084.73Aquaporin PIP1-2 OS=Zea mays GN=PIP1-2 PE=1 SV=1[more]
PIP11_VICFA1.877e-13085.29Aquaporin PIP1.1 OS=Vicia faba GN=PIP1.1 PE=2 SV=1[more]
PIP11_ARATH1.877e-13085.29Aquaporin PIP1-1 OS=Arabidopsis thaliana GN=PIP1-1... [more]
PIP13_MAIZE2.451e-13083.81Aquaporin PIP1-3/PIP1-4 OS=Zea mays GN=PIP1-3 PE=2... [more]
PIP14_ARATH3.202e-13085.71Probable aquaporin PIP1-4 OS=Arabidopsis thaliana ... [more]
PIP1_SOLLC6.676e-12884.70Probable aquaporin PIP-type pTOM75 OS=Solanum lyco... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900399 VSS Citrus sinensis cDNA clone VS28973 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900399 ID=DC900399|Name=DC900399|organism=Citrus sinensis|type=EST|length=998bp
GAGAGGCAACCCATTGGGACATCAGCTCAATCAGACAAAGACTACAAGGA
GCCACCACCAGCACCTTTGTTTGAGCCTGGTGAGCTCAAGTCATGGTCTT
TTTACAGAGCTGGTATTGCAGAGTTCATGGCTACCTTCTTGTTCCTCTAC
ATCACTGTCTTGACTGTCATGGGTGTCTCTAAGTCTAACACCAAGTGCTC
CACTGTCGGTATCCAAGGAATTGCTTGGGCCTTTGGTGGCATGATCTTTG
CGCTTGTTTACTGCACTGCTGGTATCTCAGGAGGACACATCAACCCAGCA
GTGACCTTCGGTCTGCTGCTAGCGAGGAAGCTTTCCCTGACAAGGGCTGT
CTTCTACATGGTCATGCAGTGCCTTGGTGCTGTCTGTGGTGCTGGTGTTG
TCAAGGGATTCGAAGGTTCAAAGAACTACGAGAGGTTGGGTGGTGGAGCC
AATGTTGTTGCTCACGGCTACACCAAGGGTGATGGTCTTGGTGCTGAGAT
TATTGGAACCTTTGTTCTTGTTTACACTGTCTTCTCTGCCACTGATGCGA
AGAGAAACGCCAGAGACTCTCATGTCCCTATTTTGGCCCCCCTCCCCATT
GGATTTGCTGTTTTCTTGGTCCACCTGGCCACCATCCCCATCACAGGAAC
TGGCATCAACCCAGCTAGGAGTCTTGGAGCTGCCATCATCTTCAACAAAG
ACCATGCCTGGGGATGACCATTGGATCTTTCTGGGTTGGACCCATTCATT
GGAGCTGCACTGGCTGCTGTGTACCACCAGATAGTCATCAGGGCCATTCC
CTTCAAGTCCAGGGCTTAAAAAAGTTCACTGATGGANCNTTTTTTTTTTT
AATTTGGATCTTCTTTGTCGGGTCTTTTTGTTTATGNGCATTTGGTGTTT
AACTGTTTAAAATGTTAATTAATTGTGTGTAAATTATCTAGCATTGCTGA
ATTTTTTTTTTTTTAAGCTTTTGATTGGAGGATTCATTTTTTAGTCTT
back to top