DC900396

Overview
NameDC900396
Unique NameDC900396
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length379
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7373_ARATH (UPF0737 protein AFP3 OS=Arabidopsis thaliana GN=AFP3 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.419e-33
Identity = 65/71 (91.55%), Postives = 67/71 (94.37%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYPIL 214
            EDMP VSTTGDGP+GK+I GFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP P L
Sbjct:  161 EDMPFVSTTGDGPNGKKINGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPSPFL 231          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7372_WHEAT (UPF0737 protein 2 OS=Triticum aestivum GN=AFP-B1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.374e-28
Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 208
            EDMP VS+  DGP+GK+I+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  244 EDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPAP 312          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7371_WHEAT (UPF0737 protein 1 OS=Triticum aestivum GN=AFP-A1 PE=3 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 1.374e-28
Identity = 55/69 (79.71%), Postives = 64/69 (92.75%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 208
            EDMP VS+  DGP+GK+I+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  243 EDMPMVSSKVDGPNGKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPSP 311          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7371_ORYSJ (UPF0737 protein Os03g0214200 OS=Oryza sativa subsp. japonica GN=Os03g0214200 PE=2 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 3.998e-28
Identity = 56/69 (81.16%), Postives = 64/69 (92.75%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 208
            ++MPCV T G  P+GKR+EGFLY+YRKGEEVRIVCVCHGSFL+PAEFVKHAGGGDVA+PL+HIVVNP P
Sbjct:  330 QEMPCVCTKGL-PNGKRVEGFLYKYRKGEEVRIVCVCHGSFLTPAEFVKHAGGGDVANPLRHIVVNPIP 397          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7373_WHEAT (UPF0737 protein 3 OS=Triticum aestivum GN=AFP-D1 PE=3 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 6.820e-28
Identity = 54/69 (78.26%), Postives = 63/69 (91.30%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 208
            EDMP VS+  DGP+ K+I+GFLY+YRKGEEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  238 EDMPIVSSKVDGPNSKKIDGFLYKYRKGEEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNPSP 306          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7376_MAIZE (UPF0737 protein 6 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.591e-27
Identity = 53/69 (76.81%), Postives = 63/69 (91.30%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 208
            EDMP VS+  +GP+ +RI+GFLYRY+KGE+VRIVCVCHGSFL+PAEFVKHAGGGDV +PL+HIVVNP P
Sbjct:  218 EDMPMVSSKVEGPNARRIDGFLYRYKKGEDVRIVCVCHGSFLTPAEFVKHAGGGDVPNPLRHIVVNPAP 286          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7372_ORYSJ (UPF0737 protein Os07g0602900 OS=Oryza sativa subsp. japonica GN=Os07g0602900 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 9.847e-27
Identity = 52/67 (77.61%), Postives = 62/67 (92.54%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP 202
            EDMP VS+  DGP+G++I+GFLY+YRK EEVRIVCVCHG+FL+PAEFVKHAGGGDV +PL+HIVVNP
Sbjct:  247 EDMPMVSSRVDGPNGRKIDGFLYKYRKREEVRIVCVCHGNFLTPAEFVKHAGGGDVTNPLRHIVVNP 313          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7372_ARATH (UPF0737 protein AFP2 OS=Arabidopsis thaliana GN=AFP2 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.887e-26
Identity = 49/65 (75.38%), Postives = 58/65 (89.23%), Query Frame = 2
Query:    5 DMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVN 199
            DMPCV T GDGP+G+R++G LY+Y KGEEVRI+C+CHGSFL+PAEFVKH GGGDV  PL+HIVVN
Sbjct:  278 DMPCVFTKGDGPNGRRVDGILYKYGKGEEVRIMCICHGSFLTPAEFVKHGGGGDVDRPLRHIVVN 342          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7375_MAIZE (UPF0737 protein 5 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.089e-25
Identity = 50/67 (74.63%), Postives = 60/67 (89.55%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNP 202
            EDMP VS   +GP G++ +GFLY+YRKGEEVRIVCVCHGSFL+PAEFV+HAGGG+V +PL+HIVVNP
Sbjct:  235 EDMPMVSYKAEGPGGRKTDGFLYKYRKGEEVRIVCVCHGSFLTPAEFVEHAGGGEVPNPLRHIVVNP 301          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7373_ORYSJ (UPF0737 protein Os03g0419100 OS=Oryza sativa subsp. japonica GN=Os03g0419100 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 2.426e-25
Identity = 49/68 (72.06%), Postives = 61/68 (89.71%), Query Frame = 2
Query:    5 DMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYP 208
            DMP VS+  +GP+G++I+GFLY+YRKGE+V I+CVCHG F SPAEFVKHAGGGDV++PL+HIVVNP P
Sbjct:  236 DMPMVSSKVEGPNGRKIDGFLYKYRKGEDVSIMCVCHGKFHSPAEFVKHAGGGDVSNPLRHIVVNPSP 303          
The following BLAST results are available for this feature:
BLAST of DC900396 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
U7373_ARATH1.419e-3391.55UPF0737 protein AFP3 OS=Arabidopsis thaliana GN=AF... [more]
U7372_WHEAT1.374e-2879.71UPF0737 protein 2 OS=Triticum aestivum GN=AFP-B1 P... [more]
U7371_WHEAT1.374e-2879.71UPF0737 protein 1 OS=Triticum aestivum GN=AFP-A1 P... [more]
U7371_ORYSJ3.998e-2881.16UPF0737 protein Os03g0214200 OS=Oryza sativa subsp... [more]
U7373_WHEAT6.820e-2878.26UPF0737 protein 3 OS=Triticum aestivum GN=AFP-D1 P... [more]
U7376_MAIZE2.591e-2776.81UPF0737 protein 6 OS=Zea mays PE=2 SV=1[more]
U7372_ORYSJ9.847e-2777.61UPF0737 protein Os07g0602900 OS=Oryza sativa subsp... [more]
U7372_ARATH4.887e-2675.38UPF0737 protein AFP2 OS=Arabidopsis thaliana GN=AF... [more]
U7375_MAIZE1.089e-2574.63UPF0737 protein 5 OS=Zea mays PE=2 SV=1[more]
U7373_ORYSJ2.426e-2572.06UPF0737 protein Os03g0419100 OS=Oryza sativa subsp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900396 VSS Citrus sinensis cDNA clone VS28970 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900396 ID=DC900396|Name=DC900396|organism=Citrus sinensis|type=EST|length=379bp
GGAAGATATGCCTTGTGTGTCTACAACAGGAGATGGCCCCGATGGAAAAA
GAATTGAAGGTTTTCTTTACAGATATAGGAAGGGTGAGGAAGTAAGGATC
GTATGTGTTTGTCATGGGAGCTTCCTCTCACCAGCCGAGTTTGTGAAGCA
TGCTGGTGGAGGCGATGTGGCGCACCCACTAAAGCACATTGTTGTTAACC
CTTATCCCATTTTGTAGAGCTGCCATTAAGGGTTCATGATGCTTTAAAAT
CTCTTTATTTTACATCTTTTGCGGGACGAGGCACTTGTATTGCGTTCAAT
ACATGAAGCCTCCTGTTGGGAAAAATAACAATTGTTACAGTGCACAAAAT
TGGTAAATCTACATAAGTAGTTTTCTCCG
back to top