DC900395

Overview
NameDC900395
Unique NameDC900395
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length995
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900395 vs. ExPASy Swiss-Prot
Match: CUCM1_CUCME (Cucumisin OS=Cucumis melo PE=1 SV=1)

HSP 1 Score: 242.276 bits (617), Expect = 1.303e-67
Identity = 123/259 (47.49%), Postives = 168/259 (64.86%), Query Frame = 3
Query:   18 GAAGSIMKNVVDKVSFVVSFPASALSSDNYNSMISYINTAKEPQAEILKTEAIKDSDAPVVASFSSRGPNEIAPDILKPDISAPGVDILAAYSPIAPISIDPEDKRRAKYNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIMTTAWPMKSSNNEEAEFAYGSGHINPIEAVKPGLVYETFKQDYINMLCSIGYDERKVRSISGDNSTCPEGSKQASPKDLNYPSMAAQVSAGKPFTIKFPRTVTNVGLPNSTYK 794
            GAAG +M +     +     P+S L  ++  + + YI + + P A I K+  I ++ APVV SFSSRGPN    D++KPDIS PGV+ILAA+  +AP+      +R   +NI+ GTSMSCPH  G+A YVK+++P WSP+AIKSA+MTTA PM +  N +AEFAYGSGH+NP++AV+PGLVY+  + DY+  LC  GY+ + VR I+GD S C  G+      DLNYPS    VS  + F   F RT+T+V    STY+
Sbjct:  412 GAAGVLMTSNTRDYADSYPLPSSVLDPNDLLATLRYIYSIRSPGATIFKSTTILNASAPVVVSFSSRGPNRATKDVIKPDISGPGVEILAAWPSVAPVG---GIRRNTLFNIISGTSMSCPHITGIATYVKTYNPTWSPAAIKSALMTTASPMNARFNPQAEFAYGSGHVNPLKAVRPGLVYDANESDYVKFLCGQGYNTQAVRRITGDYSACTSGN-TGRVWDLNYPSFGLSVSPSQTFNQYFNRTLTSVAPQASTYR 666          

HSP 2 Score: 36.965 bits (84), Expect = 1.303e-67
Identity = 16/31 (51.61%), Postives = 23/31 (74.19%), Query Frame = 2
Query:  782 LHLQGMLTGQLLSAALVWSDGNHNARSPIIV 874
            L ++G + G ++SA+LVWSDG H  RSPI +
Sbjct:  697 LTVRGSIKGFVVSASLVWSDGVHYVRSPITI 727          
BLAST of DC900395 vs. ExPASy Swiss-Prot
Match: XSP1_ARATH (Xylem serine proteinase 1 OS=Arabidopsis thaliana GN=XSP1 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 3.853e-51
Identity = 117/265 (44.15%), Postives = 163/265 (61.51%), Query Frame = 3
Query:    9 KKAGAAGSIMKN--VVDKVSFVVSFPASALSSDNYNSMISYINTAKEPQAEILKTEAIKDSDAPVVASFSSRGPNEIAPDILKPDISAPGVDILAAYSPIAPISIDPEDKRRAKYNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIMTTAWPMKSSNNEEAEFAYGSGHINPIEAVKPGLVYETFKQDYINMLCSIGYDERKVRSISGDNS-TCPEGSKQASPKDLNYPSMAAQVSAGKPFTIK-FPRTVTNVGLPNSTY 791
            K  G AG+I+ +   +D     ++ PA++++S   + +  YIN+ +   A I KT  +    AP VASFSSRGPN  +  +LKPDI+APG+DILAA++    ++    D + +K+ IL GTSM+CPH AGVAAYVKSFHPDW+P+AIKSAI+T+A P+    N++AEFAYG G INP  A  PGLVY+     Y+  LC  GY+   +  + G  S +C           LNYP++   + + K  T+  F R VTNVG P+S Y
Sbjct:  417 KSYGGAGAIIVSDQYLDNAQIFMA-PATSVNSSVGDIIYRYINSTRSASAVIQKTRQVT-IPAPFVASFSSRGPNPGSIRLLKPDIAAPGIDILAAFTLKRSLTGLDGDTQFSKFTILSGTSMACPHVAGVAAYVKSFHPDWTPAAIKSAIITSAKPISRRVNKDAEFAYGGGQINPRRAASPGLVYDMDDISYVQFLCGEGYNATTLAPLVGTRSVSCSSIVPGLGHDSLNYPTIQLTLRSAKTSTLAVFRRRVTNVGPPSSVY 679          
BLAST of DC900395 vs. ExPASy Swiss-Prot
Match: SUBL_ARATH (Subtilisin-like protease OS=Arabidopsis thaliana GN=ARA12 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 4.260e-50
Identity = 111/269 (41.26%), Postives = 159/269 (59.11%), Query Frame = 3
Query:    9 KKAGAAGSIMKNVVDKVSFVVS----FPASALSSDNYNSMISYINTAKEPQAEI-LKTEAIKDSDAPVVASFSSRGPNEIAPDILKPDISAPGVDILAAYSPIAPISIDPEDKRRAKYNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIMTTAWPMK---------SSNNEEAEFAYGSGHINPIEAVKPGLVYETFKQDYINMLCSIGYDERKVRSISGDNSTCPEGSKQASPKDLNYPSMAAQVSAGKPFTIKFPRTVTNVG 773
            K AG  G I+ N       +V+     PA+ +     + +  Y+ T   P A I +    +    +PVVA+FSSRGPN I P+ILKPD+ APGV+ILAA++  A  +    D RR ++NI+ GTSMSCPH +G+AA +KS HP+WSP+AI+SA+MTTA+            ++      F +G+GH++P  A  PGL+Y+   +DY+  LC++ Y   ++RS+S  N TC + SK  S  DLNYPS A  V     +  K+ RTVT+VG
Sbjct:  418 KAAGGVGMILANTAANGEELVADAHLLPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILKPDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDYLGFLCALNYTSPQIRSVSRRNYTC-DPSKSYSVADLNYPSFAVNVDGVGAY--KYTRTVTSVG 683          
BLAST of DC900395 vs. ExPASy Swiss-Prot
Match: SUBV_BACSU (Minor extracellular protease vpr OS=Bacillus subtilis GN=vpr PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 6.424e-14
Identity = 64/187 (34.22%), Postives = 97/187 (51.87%), Query Frame = 3
Query:    6 AKKAGAAGSIM-KNVVDKVSFVV---SFPASALSSDNYNSMISYINTAKEPQA-EILKTEAIKDSDAPVVASFSSRGPNEIAPDILKPDISAPGVDILAAYSPIAPISIDPEDKRRAKYNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIMTTAWPMKSSNNE-EAEFAYGSGHINPIEAVK 548
            AKKAGA G ++  N+  ++   V   S P   LS ++   ++S +   +     ++  ++A+ +     VA FSSRGP  +   ++KPDISAPGV+I++        + DP+      Y    GTSM+ PH AG  A +K   P WS   IK+AIM TA  +K S+ E     A G+G    + A+K
Sbjct:  421 AKKAGAIGMVVYNNLSGEIEANVPGMSVPTIKLSLEDGEKLVSALKAGETKTTFKLTVSKALGEQ----VADFSSRGP-VMDTWMIKPDISAPGVNIVSTIP-----THDPDHPYG--YGSKQGTSMASPHIAGAVAVIKQAKPKWSVEQIKAAIMNTAVTLKDSDGEVYPHNAQGAGSARIMNAIK 595          
BLAST of DC900395 vs. ExPASy Swiss-Prot
Match: APRX_BACSU (Serine protease aprX OS=Bacillus subtilis GN=aprX PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 8.683e-11
Identity = 47/127 (37.01%), Postives = 68/127 (53.54%), Query Frame = 3
Query:  183 SDAPVVASFSSRGPNEIAPDILKPDISAPGVDILAAYSPIAPIS-IDPEDKRRAKYNILIGTSMSCPHTAGVAAYVKSFHPDWSPSAIKSAIM--TTAWPMKSSNNEEAEFAYGSGHINPIEAVKPG 554
            SD   VASFSSRGP     +  KPDI APGV+I++  SP + I  +    +  ++Y  + GTSM+ P  AG+AA +   +PD +P  +K  +   T  W  +  N       YG+G +N   +V PG
Sbjct:  324 SDDDTVASFSSRGPTVYGKE--KPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPN------IYGAGAVNAENSV-PG 441          
The following BLAST results are available for this feature:
BLAST of DC900395 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
CUCM1_CUCME1.303e-6747.49Cucumisin OS=Cucumis melo PE=1 SV=1[more]
XSP1_ARATH3.853e-5144.15Xylem serine proteinase 1 OS=Arabidopsis thaliana ... [more]
SUBL_ARATH4.260e-5041.26Subtilisin-like protease OS=Arabidopsis thaliana G... [more]
SUBV_BACSU6.424e-1434.22Minor extracellular protease vpr OS=Bacillus subti... [more]
APRX_BACSU8.683e-1137.01Serine protease aprX OS=Bacillus subtilis GN=aprX ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900395 VSS Citrus sinensis cDNA clone VS28968 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900395 ID=DC900395|Name=DC900395|organism=Citrus sinensis|type=EST|length=995bp
CTGAGGCTAAAAAAGCTGGTGCTGCAGGATCAATCATGAAAAATGTTGTT
GACAAAGTTTCCTTCGTTGTTTCATTCCCAGCGTCGGCCTTAAGCTCTGA
CAACTACAACAGCATGATATCCTACATAAACACTGCAAAAGAGCCTCAAG
CAGAAATACTAAAAACTGAAGCAATCAAGGATTCAGATGCTCCTGTTGTC
GCTTCTTTCTCTTCACGAGGACCCAATGAAATTGCACCAGACATTTTAAA
GCCGGATATAAGTGCCCCTGGAGTAGATATCCTGGCTGCATATTCACCTA
TTGCTCCAATATCTATAGACCCGGAAGATAAAAGGCGTGCTAAATATAAT
ATTCTAATAGGAACCTCCATGTCCTGCCCGCATACTGCTGGTGTAGCCGC
ATATGTTAAATCATTTCACCCTGATTGGTCTCCTTCTGCCATCAAATCAG
CTATTATGACTACTGCATGGCCCATGAAGTCTTCCAACAATGAAGAAGCT
GAATTTGCATATGGTTCGGGGCATATCAATCCAATTGAAGCTGTAAAACC
AGGACTTGTGTATGAAACTTTCAAACAAGACTACATAAATATGCTCTGCA
GCATTGGTTATGATGAGAGAAAAGTTAGAAGCATCTCAGGAGATAACAGC
ACTTGTCCTGAAGGCTCAAAGCAAGCTTCCCCAAAAGATCTCAACTACCC
TTCAATGGCAGCTCAAGTTTCAGCTGGGAAGCCTTTCACAATCAAATTTC
CAAGGACAGTTACAAACGTTGGCCTTCCAAACTCCACTTACAAGGAATGC
TAACGGGACAACTTCTCTCTGCTGCCTTGGTGTGGTCTGATGGCAATCAT
AACGCCAGAAGCCCAATTATTGTACATGCACAGGGGGCACAAGGCTAAAA
TATATAACGCGATATGTGTAGTTGGAAATGGAATAAATTGAACTTCAATT
GCTTGCTGTACGCCCATGTTTCTTCTGAAGTTTTATTTCACTGCA
back to top