DC900391

Overview
NameDC900391
Unique NameDC900391
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1241
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3618 contig Csv1_Contig3618:126..1366. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QORL2_NEMVE (Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 5.958e-47
Identity = 115/317 (36.28%), Postives = 171/317 (53.94%), Query Frame = 3
Query:   45 PIVLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGS-FAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIG-KVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIPANIALVKNWTVHGLYWGSYKIHRPHVLEDSLRELLLWAAKG-LITIHISHTYSPSEANLAFSAIEDRKVIGKVMI 986
            P+V+        L +S  VRV V +  +N+A+ L+ +GKYQEKP LPFVPG++ SG V  VG  V++   GD V G    G   A+  V  Q+ L+ +P       AAAL +++GT+++ L H+A L  GQ                 +   V GA +I  +R  EK+  ++ +G    +D + E++   VKE        G + + + VGG + K+ LK + W   I+ +GFASGEIP IPANI LVKN +  GLYWG++  H P +L +S+ + L +   G L   +IS ++   + N AF  I  RK  GKV+I
Sbjct:   50 PLVVEDKFSTENLGTSQ-VRVAVHSCGINFADILKCIGKYQEKPELPFVPGTEISGEVVEVGSKVTSLSKGDRVLGVCGQGGGMAEECVLPQTALWKIPSSLSFTQAAALAISYGTAYIGLKHKANLQPGQTVLVTAAAGALGLASVDLAANVFGAKVIGASR-KEKLVIVQEIGATATIDYTRENIKDKVKELTDGH---GANVIMEAVGGDVFKQCLKCIAWNGYIIPVGFASGEIPQIPANILLVKNCSAVGLYWGAHSKHDPQLLRESVDKTLEYFKNGKLKGPYISASFGLDKVNEAFQMILQRKSTGKVVI 361          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QORL2_RAT (Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 4.721e-44
Identity = 110/318 (34.59%), Postives = 164/318 (51.57%), Query Frame = 3
Query:   39 KSPIVLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIG-KVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIPANIALVKNWTVHGLYWGSYKIHRPHVLEDSLRELLLWAAKGLITIHISHTYSPSEANLAFSAIEDRKVIGKVMIA 989
            K P+ + +  P P       VRV V    +N+A+ L   G+YQEKPPLPF PG ++SG V   G +VS  K GD V G +   S A+  + DQ  L+ +P+   L  AA LPV++GT+ +A+ HRA++  G+                 +   V  A +IA A   EK K     G    V+ S  S+  +VK+ + +    GV+   D VGG +  +SL+ L W  +I+V+GFA G I  +P+N+ L+KN +  GLYWG Y+     V   S+   L +  +GLI  H    +   + N AF  +  RK  GKV+++
Sbjct:   36 KQPLTIQEVAPRPI--GPQEVRVDVHFCGINFADNLVCRGQYQEKPPLPFTPGMEFSGVVLEAGADVSTVKKGDRVIGVSNFHSMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAILAVDHRARIQPGETVLVTAAAGATGLAVIDVATNVFCAKVIAAAGSDEKCKLAMQRGAQSGVNYSQGSLKDAVKKLVGS---SGVNVAIDMVGGDVFLDSLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGLYWGRYQHQDFAVFSKSMSTALQYCQQGLIHPHTGAVFKLEKVNDAFLHVMQRKSTGKVLLS 348          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QORL2_MOUSE (Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 1.794e-43
Identity = 109/318 (34.28%), Postives = 162/318 (50.94%), Query Frame = 3
Query:   39 KSPIVLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIG-KVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIPANIALVKNWTVHGLYWGSYKIHRPHVLEDSLRELLLWAAKGLITIHISHTYSPSEANLAFSAIEDRKVIGKVMIA 989
            K P+ + +  P P       VRV V    +N+A+ L   G+YQEKPPLPF PG ++SG V   G +VS  K GD V G ++  + A+  + DQ  L+ +P+   L  AA LPV++GT+ +A+ HRA++  G+                 +   V  A +IA     EK K     G    V+ S  S+  +VK   K     GV+   D VGG +  ESL+ L W  +I+V+GFA G I  +P+N+ L+KN +  GLYWG Y+     V   S+   + +  +GLI  H    +   + N AF  +  RK  GKV+++
Sbjct:   36 KQPLTIQEVAPRPV--GPQEVRVDVHFCGVNFADILACRGQYQEKPPLPFTPGMEFSGAVLETGTDVSTVKKGDRVIGVSSFHAMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAILAVDHRARIQPGETVLVTAAAGATGLAVIDVATNVFRAKVIAATGSDEKCKLAVQRGAQFSVNYSQGSLRDAVK---KLAGSGGVNVAIDMVGGDVFLESLRSLAWEGRIVVLGFAGGNIASVPSNLLLLKNISAMGLYWGRYQHQDFAVFSKSMSTAMQYCQQGLIHPHTGAVFKLEKINDAFLHVMQRKSTGKVLLS 348          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QORL2_BOVIN (Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 1.679e-41
Identity = 107/318 (33.65%), Postives = 158/318 (49.69%), Query Frame = 3
Query:   39 KSPIVLSKTEPIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIG-KVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIPANIALVKNWTVHGLYWGSYKIHRPHVLEDSLRELLLWAAKGLITIHISHTYSPSEANLAFSAIEDRKVIGKVMIA 989
            K P+V+ +  P P       VRV V    +N+A+ L   G+YQE+  LPF PG ++SG V   G +VS  K GD V G       A+  + D   L+ +P+   L  AAALPV++GT+  AL HRA    G+                 +   +  A +IA A   EK +     G    V+ S  S+  +V + + +    GV+ + D VGG +  E+L+ L +  +I+V+GFA G I  +PAN+ L+KN +  GLYWG Y+     V   SL   L +  +G I  HI   +   E N AF  +  RK  GKV+++
Sbjct:   35 KRPLVIEEVTPRPV--QPHEVRVNVHFCGINFADILACQGQYQERHQLPFTPGMEFSGMVLETGTDVSTVKEGDRVIGLPGFSGMAEECITDHKNLWQIPEKVSLREAAALPVSYGTAIFALEHRACTQPGETVLVTAAAGATGLAVIDVATNILQAKVIAAAGSDEKCQLAMQSGAQSSVNYSRGSLKEAVGKLVGS---GGVNVVIDMVGGDIFLEALRSLAYEGRIVVVGFAGGTIASVPANLLLLKNVSAMGLYWGRYRQQNFPVFSRSLSSALQYCQEGRIQPHIGEVFELEEVNDAFLHVTQRKSTGKVLLS 347          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: VAT1_DANRE (Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.478e-21
Identity = 82/321 (25.55%), Postives = 139/321 (43.30%), Query Frame = 3
Query:   90 STAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGG-------KLTKESLKLLNWGAQILVIGFASGEIPVIPA--------NIALVK-NWTVHGLYWGSYKIHRPHVLEDSLRELLLWAAKGLITIHISHTYSPSEANLAFSAIEDRKVIGKVMIAFDDMK 1004
            S  V VRVK   LN+A+ +   G Y   P  P  PG + SG ++AVG  V++ KVGD V      G + + +V   +  F +P+G     AAALPV + T+++ L     L   Q                Q+ K      +     A K + +   GV H +D      +  V++       KG+D + DP+GG        L K   KL+++GA  ++ G       V            ++L++ N +V G + G Y      +++ ++  ++    +G +   I  TY   +   A   +++R  IGK+++  + MK
Sbjct:   98 SGEVMVRVKMCGLNFADLMARQGLYDRLPSPPVTPGMECSGVIEAVGEEVTDRKVGDKVLVLNRSGMWQEVVVVASTHTFLMPEGMSFEEAAALPVNYITAYMMLFDFGHLRPNQSVLVHMAAGGVGIAATQLCKTVNDVTVFGTASASKHEVISQGGVTHPIDYRTRDYVEEVRKI----SPKGLDIVLDPLGGSDTHKGYNLLKPMGKLISYGAANMLAGQKKNLFAVAKTWYQQFSVHTLSLIQGNRSVCGFHLG-YLDSETELIDQAMTAVMDLYRQGKVKPRIDSTYHLEQVGDAMRRMQERNNIGKIILTTEPMK 413          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QOR_MOUSE (Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 3.292e-21
Identity = 71/247 (28.74%), Postives = 117/247 (47.37%), Query Frame = 3
Query:   69 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTV-CGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIPANIALVKNWTVHGL 806
            P+PQ   S  V ++V A  +N        G Y  KP LP+ PGSD +G +++VG  VS FK GD V C     G +A+F +A    ++P+P+  +    AAL + + T+  AL H A+  +G+                QI +  G  ++  A   E  K +   G   V +    + I  +K  +   K KGVD + + +  +     LKLL+ G +++V+G   G I + P +  + K  ++ G+
Sbjct:   31 PVPQ---SHQVLIKVHACGVNPVETYIRSGAYSRKPALPYTPGSDVAGIIESVGDKVSAFKKGDRVFCYSTVSGGYAEFALAADDTIYPLPETLNFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIKMSV-GDKDKGVDVIIEMLANENLSNDLKLLSHGGRVVVVG-CRGPIEINPRD-TMAKETSIIGV 271          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QOR_RAT (Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 5.616e-21
Identity = 71/247 (28.74%), Postives = 117/247 (47.37%), Query Frame = 3
Query:   69 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAAL-GSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIPANIALVKNWTVHGL 806
            P PQ   S  V ++V A  +N        G Y  KP LP+ PGSD +G +++VG  VS FK GD V  F+ + G +A+F ++  +  +P+P+  D    AAL + + T+  AL H A+  +G+                QI +  G  ++  A   E  K +   G   V +    + I  +K    +   KGVD + + +  K     LKLL+ G +++V+G   G I + P +  + K  ++ G+
Sbjct:   31 PAPQ---SHQVLIKVHACGVNPVETYIRSGTYSRKPALPYTPGSDVAGIIESVGDGVSAFKKGDRVFCFSTVSGGYAEFALSADNTTYPLPETLDFRQGAALGIPYFTACRALFHSARARAGESVLVHGASGGVGLATCQIARAHGLKVLGTAGSEEGKKLVLQNGAHEVFNHKEANYIDKIK---TSAGDKGVDVIIEMLANKNLSNDLKLLSCGGRVIVVG-CRGSIEINPRD-TMAKETSIIGV 269          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QOR_PONAB (Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.109e-20
Identity = 63/233 (27.04%), Postives = 113/233 (48.50%), Query Frame = 3
Query:   69 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAAL-GSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIP 764
            PIP+ + +    ++V A  +N        G Y  KP LP+ PGSD +G ++AVG N S FK GD V   + + G +A++ +A    ++ +P+  D    AA+ + + T++ AL+H A + +G+                QI +  G  ++  A   E  K +   G   V +    + I  +K+++     KG+D + + +      + L LL+ G Q++V+G + G I + P
Sbjct:   31 PIPKDHQAL---IKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGGNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSAHVKAGESVLVHGASGGVGLAACQIARAYGLKVLGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGE---KGIDVIIEMLANVNLNKDLSLLSHGGQVIVVG-SRGTIEINP 256          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: QOR_HUMAN (Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.806e-19
Identity = 64/233 (27.47%), Postives = 113/233 (48.50%), Query Frame = 3
Query:   69 PIPQLNSSTAVRVRVKATSLNYANYLQILGKYQEKPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAAL-GSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIGFASGEIPVIP 764
            PIP+ +    V ++V A  +N        G Y  KP LP+ PGSD +G ++AVG N S FK GD V   + + G +A++ +A    ++ +P+  D    AA+ + + T++ AL+H A + +G+                QI +  G  I+  A   E  K +   G   V +    + I  +K+++     KG+D + + +      + L LL+ G +++V+G + G I + P
Sbjct:   31 PIPKDHQ---VLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGE---KGIDIIIEMLANVNLSKDLSLLSHGGRVIVVG-SRGTIEINP 256          
BLAST of DC900391 vs. ExPASy Swiss-Prot
Match: PHAS_MYCTU (Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis GN=pks2 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 5.256e-19
Identity = 78/301 (25.91%), Postives = 135/301 (44.85%), Query Frame = 3
Query:   99 VRVRVKATSLNYANYLQILGKYQE-KPPLPFVPGSDYSGTVDAVGPNVSNFKVGDTVCGFAALGSFAQFIVADQSELFPVPKGCDLLAAAALPVAFGTSHVALVHRAQLSSGQXXXXXXXXXXXXXXXXQIGKVCGATIIAVARGAEKIKFLKSLGVDHVVDLSNESVIPSVKEFLKARKLKGVDXLYDPVGGKLTKESLKLLNWGAQILVIG----FASGEIPVIPANIALVKNWTVHGLYWGSYKIHRPHVLEDSLRELLLWAAKGLITIHISHTYSPSEANLAFSAIEDRKVIGKVMI 986
            + V V+A+S+N+A+ L   G+Y   +  LP + G+D++G V AVGP V++ KVGD V G +  G +  F+  D      +P G     AAA+  A  T+   L   A++ +G                  I +  GA I A A   ++ + L+++G++HV D  +      ++     R   GVD + + V G      LKLL +  + + IG    +   ++ + P      +N + + +  G      P  L D L  +    A G + +  S  Y   EA  A   + + +  GK+++
Sbjct: 1456 IEVAVRASSVNFADVLIAFGRYPSFEGHLPQL-GTDFAGVVTAVGPGVTDHKVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDAQAAAVTTAHATAWYGLHELARIRAGDTVLIHSGTGGVGQAAIAIARAAGAEIFATAGTPQRRELLRNMGIEHVYDSRSIEFAEQIRRDTNGR---GVDVVLNSVTGAAQLAGLKLLAFRGRFVEIGKRDIYGDTKLGLFPFR----RNLSFYAVDLGLLSATHPEELRDLLGTVYRLTAAGELPMPQSTHYPLVEAATAIRVMGNAEHTGKLVL 1748          
The following BLAST results are available for this feature:
BLAST of DC900391 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
QORL2_NEMVE5.958e-4736.28Quinone oxidoreductase-like protein 2 homolog OS=N... [more]
QORL2_RAT4.721e-4434.59Quinone oxidoreductase-like protein 2 OS=Rattus no... [more]
QORL2_MOUSE1.794e-4334.28Quinone oxidoreductase-like protein 2 OS=Mus muscu... [more]
QORL2_BOVIN1.679e-4133.65Quinone oxidoreductase-like protein 2 OS=Bos tauru... [more]
VAT1_DANRE1.478e-2125.55Synaptic vesicle membrane protein VAT-1 homolog OS... [more]
QOR_MOUSE3.292e-2128.74Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=... [more]
QOR_RAT5.616e-2128.74Quinone oxidoreductase OS=Rattus norvegicus GN=Cry... [more]
QOR_PONAB8.109e-2027.04Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=... [more]
QOR_HUMAN1.806e-1927.47Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=... [more]
PHAS_MYCTU5.256e-1925.91Phthioceranic/hydroxyphthioceranic acid synthase O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900391 VSS Citrus sinensis cDNA clone VS28964 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900391 ID=DC900391|Name=DC900391|organism=Citrus sinensis|type=EST|length=1241bp
GGAAACTGGGCGATCCAACGGTCTCAATTCACGATGAAAAATCGCCGATT
GTGTTGAGTAAAACTGAGCCAATTCCACAATTGAATTCTTCAACTGCAGT
TAGAGTCAGAGTGAAAGCCACCAGCTTGAACTACGCTAATTACTTGCAGA
TATTGGGGAAATATCAAGAGAAACCACCATTGCCCTTCGTCCCCGGCTCC
GATTATTCGGGCACTGTTGATGCGGTGGGCCCCAATGTCTCAAATTTCAA
AGTGGGTGACACTGTTTGTGGATTTGCTGCCCTTGGCTCCTTTGCCCAAT
TCATCGTCGCTGATCAGTCAGAATTGTTTCCAGTGCCAAAGGGATGTGAT
TTGTTGGCTGCTGCTGCACTTCCTGTTGCATTTGGAACCTCACATGTTGC
TCTTGTTCATCGGGCCCAATTGTCCTCCGGTCAGGTCTTGCTTGTTCTTG
GTGCTGCTGGAGGTGTTGGTGTTGCCGCTGTTCAAATTGGCAAGGTTTGC
GGAGCCACTATCATTGCCGTTGCTAGGGGTGCTGAAAAGATAAAATTTTT
GAAGTCATTGGGCGTCGATCATGTAGTTGACTTGAGCAATGAGAGTGTCA
TTCCGAGTGTCAAAGAGTTCCTCAAGGCAAGGAAACTCAAAGGGGTTGAT
GNTCTATATGATCCTGTTGGAGGCAAGCTTACTAAAGAATCCTTGAAGCT
TTTGAACTGGGGTGCTCAAATCTTAGTCATTGGCTTTGCAAGTGGGGAGA
TTCCAGTAATCCCTGCTAATATTGCTCTTGTTAAGAACTGGACGGTACAC
GGACTTTACTGGGGTAGCTATAAAATACATCGCCCTCATGTGCTTGAAGA
TTCTCTTAGGGAGTTACTCTTATGGGCTGCAAAGGGCTTGATTACCATCC
ATATTTCTCATACTTACAGTCCATCAGAGGCCAACCTTGCCTTCTCTGCC
ATTGAAGATAGGAAAGTAATTGGAAAGGTGATGATTGCTTTTGATGACAT
GAAAAGTATCAGGCCTAGGCTTTAAGTTGATCATCATTACTGGGCTGGTA
TGCAATGGAGAATGTTTCTGCGGCTCTTGATCATCAAAATTAGCCTTAAT
TAATACATGGCACATTTAGTTGCTCTTATATGAGAGAAAATCTATGACTT
TGTTGTGAAGCATGAGAATGCAAGTCCCTGGCAATTAAGGTTGTCAAAAT
TTGGATAACAATGAATGCGAAATAAGTACCGTAAAACCTTC
back to top