DC900388

Overview
NameDC900388
Unique NameDC900388
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length411
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4121 contig Csv1_Contig4121:702..1112. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900388 vs. ExPASy Swiss-Prot
Match: PLZ12_LUPPO (Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.180e-26
Identity = 51/84 (60.71%), Postives = 73/84 (86.90%), Query Frame = 2
Query:    2 LSGLGIARQRQAIVDGLRDSVLAFSENVPGTTSKDVMDMVLVTQYFDTMKEIGASSKSSSVFIPHGPGAVKDIATQIREGLLQA 253
            L G+G+ARQRQAI DGLR+++L FS  V GT++K+VMD++++TQYFDT+K++G SSK+++VFIPHGPG V+DI  QIR GL+++
Sbjct:   87 LGGVGVARQRQAITDGLRENILNFSHKVEGTSAKEVMDLIMITQYFDTIKDLGNSSKNTTVFIPHGPGHVRDIGEQIRNGLMES 170          
The following BLAST results are available for this feature:
BLAST of DC900388 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PLZ12_LUPPO2.180e-2660.71Protein PPLZ12 OS=Lupinus polyphyllus GN=PPLZ12 PE... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900388 VSS Citrus sinensis cDNA clone VS28961 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900388 ID=DC900388|Name=DC900388|organism=Citrus sinensis|type=EST|length=411bp
CCTGTCCGGACTTGGGATAGCACGTCAGCGCCAGGCTATTGTTGATGGGT
TAAGAGACAGTGTGCTTGCCTTCTCTGAGAATGTTCCTGGAACAACCTCC
AAGGATGTCATGGACATGGTTCTGGTGACTCAATACTTCGACACCATGAA
GGAGATTGGAGCATCCTCGAAGTCCTCATCTGTTTTTATCCCACATGGAC
CTGGTGCTGTTAAGGACATTGCTACACAAATCAGGGAGGGACTCCTTCAG
GCCAATCAAGTTCAGAAGTAGATATTCTGCTGATATGCTAAGTCCTTTAC
TAGTCCTAGTGCTTATCATAGTCCTGCATTTGGTGTTTCTAATATCTAAA
CTTTATTAGTATTTTATTCCAAGCACCGTCCTTTGTTATATTATTACTTG
CACAATGGGGG
back to top