DC900387

Overview
NameDC900387
Unique NameDC900387
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length699
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1707..2408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 1.312e-60
Identity = 103/122 (84.43%), Postives = 113/122 (92.62%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K+   VIAE+TVR LQRT+PAAVPA+VFLSGGQSEEEAT NLNAMN+L TKKPWSLSFSFGRALQQSTLKAW+GK EN++KA+AAFL RCKANSEATLGTYKGDA LGEGA+ESLHVKDYKY
Sbjct:  237 KVSPEVIAEYTVRTLQRTVPAAVPAIVFLSGGQSEEEATLNLNAMNKLSTKKPWSLSFSFGRALQQSTLKAWSGKAENIEKARAAFLTRCKANSEATLGTYKGDAVLGEGASESLHVKDYKY 358          

HSP 2 Score: 43.1282 bits (100), Expect = 1.312e-60
Identity = 19/22 (86.36%), Postives = 21/22 (95.45%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGTLLKPNMVTPGS+A KV+PE
Sbjct:  220 EGTLLKPNMVTPGSDAKKVSPE 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 6.444e-60
Identity = 102/123 (82.93%), Postives = 113/123 (91.87%), Query Frame = 2
Query:   56 PKLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            PK+   V+AEHTVRALQRT+PAAVPAVVFLSGGQSEEEAT NLNA+NQ+K KKPW+LSFSFGRALQQSTLKAW+GKEENV+ AQ A L R KANSEATLGTYKG++QLGEGA+ESLHVKDYKY
Sbjct:  237 PKVAPEVVAEHTVRALQRTVPAAVPAVVFLSGGQSEEEATVNLNAINQVKGKKPWTLSFSFGRALQQSTLKAWSGKEENVKNAQDALLTRAKANSEATLGTYKGNSQLGEGASESLHVKDYKY 359          

HSP 2 Score: 44.669 bits (104), Expect = 6.444e-60
Identity = 19/22 (86.36%), Postives = 21/22 (95.45%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGTLLKPNMVTPGS++PKV PE
Sbjct:  221 EGTLLKPNMVTPGSDSPKVAPE 242          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.692e-57
Identity = 99/123 (80.49%), Postives = 108/123 (87.80%), Query Frame = 2
Query:   56 PKLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            PK+   VIAEHTVRALQRT+PAAVPAVVFLSGGQSEEEA+ NLNA+NQ+K KKPW+LSFSFGRALQQSTLKAW GK ENV+ AQ A L R KANSEATLGTYKG + LG GA+ESLHVKDYKY
Sbjct:  237 PKVAPEVIAEHTVRALQRTVPAAVPAVVFLSGGQSEEEASVNLNAINQIKGKKPWTLSFSFGRALQQSTLKAWGGKTENVKAAQDALLTRAKANSEATLGTYKGASNLGAGASESLHVKDYKY 359          

HSP 2 Score: 45.8246 bits (107), Expect = 1.692e-57
Identity = 20/22 (90.91%), Postives = 21/22 (95.45%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGTLLKPNMVTPGS+APKV PE
Sbjct:  221 EGTLLKPNMVTPGSDAPKVAPE 242          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 9.042e-56
Identity = 99/122 (81.15%), Postives = 107/122 (87.70%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K+   VIAE+TVR LQRT+PAAVPAV+FLSGGQSEEEATRNLNAMN+L TKKPWSLSFSFGRALQ STLKAWAGK EN++KA+AAFL RCKANSEATLGTYKGDA       ESLHVKDYKY
Sbjct:  237 KVTPEVIAEYTVRTLQRTVPAAVPAVLFLSGGQSEEEATRNLNAMNKLSTKKPWSLSFSFGRALQASTLKAWAGKVENLEKARAAFLARCKANSEATLGTYKGDA---AADTESLHVKDYKY 355          

HSP 2 Score: 43.5134 bits (101), Expect = 9.042e-56
Identity = 19/22 (86.36%), Postives = 21/22 (95.45%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGTLLKPNMVTPGS++ KVTPE
Sbjct:  220 EGTLLKPNMVTPGSDSKKVTPE 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 8.077e-51
Identity = 92/122 (75.41%), Postives = 102/122 (83.61%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K+   VIAE+TVR LQRT+P AVP V+FLSGGQSEEEAT NLNAMN+L+TKKPW+LSFS+GRALQQSTLKAW GKEENV KAQ  FL R K NSEATLG Y+G A  G  A+ESLHVKDYKY
Sbjct:  237 KVTPEVIAEYTVRTLQRTVPQAVPGVMFLSGGQSEEEATLNLNAMNKLETKKPWTLSFSYGRALQQSTLKAWQGKEENVAKAQEVFLARAKGNSEATLGKYQGGAG-GADASESLHVKDYKY 357          

HSP 2 Score: 40.817 bits (94), Expect = 8.077e-51
Identity = 18/22 (81.82%), Postives = 20/22 (90.91%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGT LKPN+VTPGSE+ KVTPE
Sbjct:  220 EGTSLKPNIVTPGSESKKVTPE 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 2.332e-50
Identity = 88/123 (71.54%), Postives = 100/123 (81.30%), Query Frame = 2
Query:   56 PKLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            PK+   VI E+TV AL+RT+PAAVP +VFLSGGQSEE+AT NLNAMN+    KPW+LSFSFGRALQQSTLK W+GK+ENV KAQ  FL RCKANSEATLG Y G +  G  A+ESLHVKDYKY
Sbjct:  236 PKVSPEVIGEYTVNALRRTVPAAVPGIVFLSGGQSEEQATLNLNAMNKFDVVKPWTLSFSFGRALQQSTLKTWSGKKENVGKAQDVFLARCKANSEATLGKYGGGSGTGL-ASESLHVKDYKY 357          

HSP 2 Score: 45.0542 bits (105), Expect = 2.332e-50
Identity = 19/22 (86.36%), Postives = 22/22 (100.00%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGTLLKPNMVTPGS++PKV+PE
Sbjct:  220 EGTLLKPNMVTPGSDSPKVSPE 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 1.430e-43
Identity = 77/123 (62.60%), Postives = 92/123 (74.80%), Query Frame = 2
Query:   56 PKLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            PK+   +IAE+TV AL+RT+P A+P +VFLSG Q EE+AT NLNAMN+L   KPW+L+FSFG ALQQS +KAWAGK ENV KAQA FL RCKAN +ATLG Y G A     A E+L V  Y+Y
Sbjct:  236 PKVAPELIAEYTVTALRRTVPPAIPGIVFLSGIQREEQATLNLNAMNKLDVLKPWTLTFSFGGALQQSAIKAWAGKPENVAKAQAKFLTRCKANKDATLGKYTGWASGDSAAFENLVVIGYRY 358          

HSP 2 Score: 44.669 bits (104), Expect = 1.430e-43
Identity = 19/22 (86.36%), Postives = 21/22 (95.45%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPE 72
            EGTLLKPNMVTPGS++PKV PE
Sbjct:  220 EGTLLKPNMVTPGSDSPKVAPE 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF1_CAEEL (Fructose-bisphosphate aldolase 1 OS=Caenorhabditis elegans GN=aldo-1 PE=1 SV=1)

HSP 1 Score: 133.65 bits (335), Expect = 2.393e-33
Identity = 66/112 (58.93%), Postives = 83/112 (74.11%), Query Frame = 2
Query:   89 TVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            TV ALQR +P+AVP VVFLSGGQSEE+AT NLNA+NQ+  KKPW+L+FS+GRALQ S L  WAGK+EN+  AQ   L R + NS A++G Y GDA     A++SL V ++ Y
Sbjct:  255 TVTALQRGVPSAVPGVVFLSGGQSEEDATLNLNAINQVSGKKPWALTFSYGRALQASCLAKWAGKDENIAAAQEVLLHRAQVNSLASVGKYTGDASADAAASQSLFVANHSY 366          

HSP 2 Score: 28.1054 bits (61), Expect = 2.393e-33
Identity = 12/13 (92.31%), Postives = 12/13 (92.31%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG 45
            EGTLLKPNMVT G
Sbjct:  226 EGTLLKPNMVTSG 238          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF2_CAEEL (Fructose-bisphosphate aldolase 2 OS=Caenorhabditis elegans GN=aldo-2 PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 4.058e-33
Identity = 67/122 (54.92%), Postives = 82/122 (67.21%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K     I   TV AL+R +PAAVP + FLSGGQSE +AT NLNA+N ++  KPW L+FS+GRALQ S LKAW GK+EN+  AQ   L R KAN +A+LG Y G+   G  AAESL V  + Y
Sbjct:  246 KASHEAIGLATVTALRRGVPAAVPGITFLSGGQSELDATANLNAINSVQLGKPWKLTFSYGRALQASVLKAWGGKDENIAAAQKTLLHRSKANGDASLGKYAGEDAAG-AAAESLFVAKHSY 366          

HSP 2 Score: 32.7278 bits (73), Expect = 4.058e-33
Identity = 17/23 (73.91%), Postives = 18/23 (78.26%), Query Frame = 1
Query:    7 EGTLLKPNMVTPG-SEAPKVTPE 72
            EGTLLKPNMVTPG S A K + E
Sbjct:  228 EGTLLKPNMVTPGQSSASKASHE 250          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_DANRE (Fructose-bisphosphate aldolase B OS=Danio rerio GN=aldob PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 6.884e-33
Identity = 65/116 (56.03%), Postives = 80/116 (68.97%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL+RT+PAAVP + FLSGGQSEEEA+ NLNAMNQL   +PW LSFS+GRALQ S L AW G+  N + +Q AF+ R K NS A+ G YK   Q G+ + +SL    Y Y
Sbjct:  249 VAMATVTALRRTVPAAVPGICFLSGGQSEEEASLNLNAMNQLSLHRPWKLSFSYGRALQASALSAWKGQAANKKASQDAFVTRAKINSLASKGEYKPSGQAGQASTQSLFTASYTY 364          

HSP 2 Score: 29.261 bits (64), Expect = 6.884e-33
Identity = 13/18 (72.22%), Postives = 13/18 (72.22%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPK 60
            EGTLLKPNMVT G    K
Sbjct:  225 EGTLLKPNMVTAGHSCTK 242          
The following BLAST results are available for this feature:
BLAST of DC900387 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALF_ORYSJ1.312e-6084.43Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_CICAR6.444e-6082.93Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA1.692e-5780.49Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_MAIZE9.042e-5681.15Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_SPIOL8.077e-5175.41Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA2.332e-5071.54Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH1.430e-4362.60Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_CAEEL2.393e-3358.93Fructose-bisphosphate aldolase 1 OS=Caenorhabditis... [more]
ALF2_CAEEL4.058e-3354.92Fructose-bisphosphate aldolase 2 OS=Caenorhabditis... [more]
ALDOB_DANRE6.884e-3356.03Fructose-bisphosphate aldolase B OS=Danio rerio GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900387 VSS Citrus sinensis cDNA clone VS28960 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900387 ID=DC900387|Name=DC900387|organism=Citrus sinensis|type=EST|length=699bp
CCCTCTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTGGATCTGA
AGCTCCCAAAGTTACACCGGAGGGTGATTGCTGAACACACTGTCCGGGCC
CTGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTTGTCTGG
TGGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGAACCAGC
TCAAGACGAAGAAGCCATGGTCACTTTCCTTTTCCTTTGGACGTGCACTT
CAGCAGAGCACTCTCAAGGCATGGGCTGGAAAGGAAGAGAATGTGCAGAA
GGCCCAGGCTGCTTTCCTTGTCAGGTGCAAGGCCAACTCTGAGGCTACCC
TCGGTACTTACAAGGGCGATGCCCAGCTTGGTGAAGGTGCCGCAGAGTCT
CTCCATGTCAAGGACTACAAATACTAAGCACAGTTGAAGCTTTGGGTGTT
GTGCTTTATGAACTTTATGAGAGTAAATGGCGGTATGAACATTAGGTTGG
CACATTCTCATTCATAGTTTTAGGGCTTTTTCATATTAGGTGGAGCAATA
AAAAGCTTGGGAACTTCGGTTTGAGTGGTTTTGATCAAAACTAAACTGAA
AACTGTTTATGCTTTTGTTTTTGTTTTTTTTTTCCTTTTCCCCTAATGGC
GCTAAATTTCTGTGATTTTGTCACATAATTGATAATGTTTTCTTGTGCT
back to top