DC900386

Overview
NameDC900386
Unique NameDC900386
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1022..1673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 3.153e-86
Identity = 158/182 (86.81%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   35 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKR +SINVENVE NRR+LRELLFCTPGALQYLSGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+AGT  ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVP++
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIV 182          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 4.118e-86
Identity = 158/182 (86.81%), Postives = 167/182 (91.76%), Query Frame = 2
Query:   35 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVE NRRALRELLFC PGALQY+SGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+ GT+ ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVP++
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIV 182          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 2.669e-85
Identity = 157/182 (86.26%), Postives = 166/182 (91.21%), Query Frame = 2
Query:   35 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            M+ ++GKYADELI NA+YI TPGK ILAADESTGTIGKR  SINVENVESNRRALRELLF TPGAL YLSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENGLVP++
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIV 182          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 7.268e-83
Identity = 156/183 (85.25%), Postives = 164/183 (89.62%), Query Frame = 2
Query:   35 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGLVPLL 580
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRL+SINVENVE+NRRALRELLF  P  LQYLSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENGLVP++
Sbjct:    1 MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIV 183          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.619e-82
Identity = 157/183 (85.79%), Postives = 166/183 (90.71%), Query Frame = 2
Query:   35 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGA-LQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNR+ALRELLF      LQYLSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENGLVP++
Sbjct:    1 MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIV 183          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 8.885e-81
Identity = 146/179 (81.56%), Postives = 163/179 (91.06%), Query Frame = 2
Query:   35 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLV 571
            MS F GKYADELIKNA YI TPGKGILAADESTGTIGKRL+SINVEN+E+NR+ALRELLF +P ALQYLSGVILFEETLYQK++ GKPFV++L+E  V+PGIKVDKG VELAGT+GETTTQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENGLV
Sbjct:    1 MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLV 179          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 273.478 bits (698), Expect = 6.819e-73
Identity = 137/182 (75.27%), Postives = 151/182 (82.97%), Query Frame = 2
Query:   35 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            MS F  KY DELIK A YI TPG+GILAADEST TIGKR + INVEN ESNR+A RELLF +PG+   LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG V+LAGTNGETTTQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENGLVP++
Sbjct:    1 MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIV 182          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 9.559e-59
Identity = 120/179 (67.04%), Postives = 139/179 (77.65%), Query Frame = 2
Query:   53 KYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTP-GALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            K+ADELI  A  I  PGKGILAADEST TIG R   IN+EN E NRRA RELL  T  G  +++ G+IL+EETLYQK A G+ F DVL+E  +  GIKVDKG V + GT+GET+TQGLDGLA+RC+KYYEAGARFAKWRAVLKI    N PSQL+I ENA+ LARYA ICQENGLVP++
Sbjct:    4 KFADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIV 182          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_ECHMU (Fructose-bisphosphate aldolase OS=Echinococcus multilocularis GN=FBPA PE=2 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.248e-58
Identity = 116/173 (67.05%), Postives = 135/173 (78.03%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL +NA+ I  PGKG+LAADEST TIGKR ++IN+EN E NRRA RELLF T P   +++SGVILF ET+YQKT  GKPFV++L+E GVLPGIKVD G V L GT  E TTQGLD LAQRC +YY  G RFAKWR VLKI  + PS LA+ ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELRENASAIVAPGKGLLAADESTNTIGKRFAAINLENTEENRRAYRELLFTTDPEFAKHISGVILFHETVYQKTKDGKPFVELLRERGVLPGIKVDLGVVPLGGTADECTTQGLDNLAQRCAQYYNDGCRFAKWRCVLKISSHNPSYLAMLENANVLARYAFICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.993e-56
Identity = 113/173 (65.32%), Postives = 136/173 (78.61%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL + A  I + GKGILAADESTGT+GKRLS+I VENV+ NRR  R+LLF + P   + + GVI +EETLYQKT  G PFV ++K+ G++ GIKVDKGTV LAGT+GE+TTQGLDGLA+RC +Y + GA FAKWR VLKI  N PS LAI ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIV 187          
The following BLAST results are available for this feature:
BLAST of DC900386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_ORYSJ3.153e-8686.81Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_MAIZE4.118e-8686.81Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_SPIOL2.669e-8586.26Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR7.268e-8385.25Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA1.619e-8285.79Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA8.885e-8181.56Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH6.819e-7375.27Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI9.559e-5967.04Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF_ECHMU1.248e-5867.05Fructose-bisphosphate aldolase OS=Echinococcus mul... [more]
ALF2_LAMJA1.993e-5665.32Fructose-bisphosphate aldolase, non-muscle type OS... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900386 VSS Citrus sinensis cDNA clone VS28960 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900386 ID=DC900386|Name=DC900386|organism=Citrus sinensis|type=EST|length=652bp
ACAAAACAAATTTTCTATCTTCAAGTCGATCACCATGTCTTGCTTCAAGG
GCAAATACGCCGATGAGCTCATTAAAAATGCTGCCTACATTGGCACCCCT
GGAAAGGGTATCCTTGCTGCTGATGAGTCAACAGGCACCATTGGCAAGCG
TCTATCCAGCATCAATGTTGAGAATGTTGAGTCAAACAGGCGTGCTCTCC
GCGAGCTCCTTTTCTGCACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTC
ATCCTCTTCGAGGAGACCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTT
TGTTGATGTCTTGAAGGAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACA
AGGGTACTGTTGAGCTTGCTGGTACCAATGGTGAGACCACCACCCAGGGT
CTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTATGAAGCTGGTGCTCG
TTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGC
AGCTGGCCATCAATGAGAATGCCAATGGCCTGGCCCGATATGCTATCATC
TGCCAGGAGAATGGCCTTGTTCCATTGTTGACCTGAGATCCTTGNTGCGG
CCCATGCATCACAGTGTGCTGTGTACCGAGCGTGTCTGCTGATCTCAGCT
TA
back to top