DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_XENTR (WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 6.124e-37
Identity = 75/182 (41.21%), Postives = 116/182 (63.74%), Query Frame = 3
Query:   99 ATWNLIATLSIXRPE-GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            AT + +  ++I   E G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +SP D ++L +AS D ++ I + +  SL   +SGH  WVL+V  SPD     + SSD++VK+WD++ R  + +  +H DQVWGV +   G ++VSV+DD+ I +Y+
Sbjct:  122 ATGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-DSQLLVTASDDGYIKIYEVQHASLAATLSGHGSWVLNVAFSPDDTHFVSSSSDKSVKVWDVSARTCVHTFLDHQDQVWGVKYNKNGSKIVSVADDQEIHVYD 302          

HSP 2 Score: 77.0258 bits (188), Expect = 1.623e-13
Identity = 51/154 (33.12%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  189 SVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            SVA+SPD + +A GS  G  ++F V   K  + L+        + YSP D + L S + D  ++I D A GK L T + GHA  + S+  SPD   + T S D  +K++++   +   +++ H   V  V+F P     VS S DKS+ +++ S
Sbjct:  111 SVAFSPDSQHLATGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSP-DGKYLASGAIDGIINIFDIATGKLLHT-LEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYEVQHASLAATLSGHGSWVLNVAFSPDDTHFVSSSSDKSVKVWDVS 262          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_DANRE (WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 6.124e-37
Identity = 70/166 (42.17%), Postives = 107/166 (64.46%), Query Frame = 3
Query:  144 GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +SP D ++L +AS D ++ I D +  +L   +SGH  WVLSV  SPD     + SSD+++K+WD + R+ + +  +H DQVW V + P G ++VS  DD++I +Y+
Sbjct:  138 GKKEHSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-DSQLLVTASDDGYIKIYDVQHANLAGTLSGHGSWVLSVAFSPDDTHFVSSSSDKSIKVWDTSSRSCVNTFFDHQDQVWSVKYNPTGSKIVSAGDDRAIHIYD 302          

HSP 2 Score: 78.9518 bits (193), Expect = 4.270e-14
Identity = 61/189 (32.28%), Postives = 90/189 (47.62%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            +LWD  T   I ++         P D  +       VA+SPD + IA GS  G  ++F V   K  H L+        + YSP D + L S + D  ++I D A GK L T + GHA  + S+  SPD   + T S D  +K++D+       +++ H   V  V+F P     VS S DKSI +++ S
Sbjct:   89 RLWDLETGKQIKSMDAG------PVDAWT-------VAFSPDSKYIATGSHLGKVNIFGVESGKKEHSLDTRGKFILSIAYSP-DGKYLASGAIDGIINIFDIATGKLLHT-LEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHGSWVLSVAFSPDDTHFVSSSSDKSIKVWDTS 262          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_XENLA (WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 7.998e-37
Identity = 76/182 (41.76%), Postives = 115/182 (63.19%), Query Frame = 3
Query:   99 ATWNLIATLSIXRPE-GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            AT + +  ++I   E G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +S  D ++L +AS D ++ I D +  SL   +SGH  WVL+V  SPD A   + SSD++VK+WD++ R  + +  +H DQVWGV +   G ++VSV DD+ I +Y+
Sbjct:  122 ATGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFS-TDSQLLVTASDDGYIKIYDVQHASLAATLSGHGSWVLNVAFSPDDAHFVSSSSDKSVKVWDVSARTCVHTFLDHQDQVWGVKYNRNGSKIVSVGDDQEIHVYD 302          

HSP 2 Score: 76.2554 bits (186), Expect = 2.768e-13
Identity = 51/154 (33.12%), Postives = 80/154 (51.95%), Query Frame = 3
Query:  189 SVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            SVA+SPD + +A GS  G  ++F V   K  + L+        + YSP D + L S + D  ++I D A GK L T + GHA  + S+  S D   + T S D  +K++D+   +   +++ H   V  V+F P     VS S DKS+ +++ S
Sbjct:  111 SVAFSPDSQHLATGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSP-DGKYLASGAIDGIINIFDIATGKLLHT-LEGHAMPIRSLTFSTDSQLLVTASDDGYIKIYDVQHASLAATLSGHGSWVLNVAFSPDDAHFVSSSSDKSVKVWDVS 262          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_HUMAN (WD repeat-containing protein 61 OS=Homo sapiens GN=WDR61 PE=1 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.039e-36
Identity = 71/166 (42.77%), Postives = 106/166 (63.86%), Query Frame = 3
Query:  144 GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +SP D ++L +AS D ++ I D +  +L   +SGHA WVL+V   PD     + SSD++VK+WD+  R  + +  +H DQVWGV +   G ++VSV DD+ I +Y+
Sbjct:  138 GKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-DSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYD 302          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_BOVIN (WD repeat-containing protein 61 OS=Bos taurus GN=WDR61 PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.039e-36
Identity = 71/166 (42.77%), Postives = 106/166 (63.86%), Query Frame = 3
Query:  144 GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +SP D ++L +AS D ++ I D +  +L   +SGHA WVL+V   PD     + SSD++VK+WD+  R  + +  +H DQVWGV +   G ++VSV DD+ I +Y+
Sbjct:  138 GKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-DSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHIYD 302          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_RAT (WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.969e-36
Identity = 71/166 (42.77%), Postives = 106/166 (63.86%), Query Frame = 3
Query:  144 GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +SP D ++L +AS D ++ I D +  +L   +SGHA WVL+V   PD     + SSD++VK+WD+  R  + +  +H DQVWGV +   G ++VSV DD+ I +Y+
Sbjct:  138 GKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-DSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHVYD 302          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_MOUSE (WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.969e-36
Identity = 71/166 (42.77%), Postives = 106/166 (63.86%), Query Frame = 3
Query:  144 GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +SP D ++L +AS D ++ I D +  +L   +SGHA WVL+V   PD     + SSD++VK+WD+  R  + +  +H DQVWGV +   G ++VSV DD+ I +Y+
Sbjct:  138 GKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-DSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEIHVYD 302          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR61_CHICK (WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 8.843e-36
Identity = 74/182 (40.66%), Postives = 112/182 (61.54%), Query Frame = 3
Query:   99 ATWNLIATLSIXRPE-GLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            AT + +  ++I   E G K     +  KF+LS+A+SPDG+ +A G++DG  ++FD+   K LH LEGH MP R L +SP D ++L +AS D ++ I D +  +L   +SGH  WVL+V   PD     + SSD++VK+WD   R  + +  +H DQVWGV +   G ++VSV DD+ I +Y+
Sbjct:  122 ATGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSP-DSQLLVTASDDGYIKIYDVQHANLAGTLSGHGSWVLNVAFCPDDTHFVSSSSDKSVKVWDAGTRTCVHTFFDHQDQVWGVKYNGSGSKIVSVGDDQEIHIYD 302          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: HETE1_PODAN (Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.848e-25
Identity = 68/189 (35.98%), Postives = 91/189 (48.15%), Query Frame = 3
Query:   75 HEXKLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            H  K+WD A+     TL                   VLSVA+SPDG+R+A GS D T  ++D         LEGH      + +SP   RV  S S D  + I D    +    + GH  WV SV  SPDG  + +GS D T+K+WD       Q++  H D VW V+F P G RV S S D +I +++
Sbjct:  947 HTIKIWDAASGTCTQTLE-------------GHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGSVWSVAFSPDGQRVA-SGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVASGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWD 1121          

HSP 2 Score: 115.161 bits (287), Expect = 5.377e-25
Identity = 69/189 (36.51%), Postives = 95/189 (50.26%), Query Frame = 3
Query:   75 HEXKLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            H  K+WD  +     TL     EG   +        V SVA+SPDG+R+A GS+DGT  ++D         LEGH      + +SP   RV  S S D  + I DA   +    + GH  WV SV  SPDG  + +GSSD+T+K+WD       Q++  H   V  V+F P G RV S S D +I +++
Sbjct: 1073 HTIKIWDAVSGTCTQTL-----EGHGDS--------VWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVA-SGSIDGTIKIWDAASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDKTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDNTIKIWD 1247          

HSP 3 Score: 113.235 bits (282), Expect = 2.043e-24
Identity = 70/186 (37.63%), Postives = 95/186 (51.08%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K+WDTA+     TL     EG   +        V SVA+SPD  R+A GS D T  ++D         LEGH    + + +SP   RV  S S D  + I DA   +    + GH   VLSV  SPDG  + +GS D+T+K+WD       Q++  H   VW V+F P G RV S SDDK+I +++
Sbjct:  866 KIWDTASGTGTQTL-----EGHGGS--------VWSVAFSPDRERVASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPDGQRVA-SGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGSVWSVAFSPDGQRVASGSDDKTIKIWD 1037          

HSP 4 Score: 102.449 bits (254), Expect = 3.607e-21
Identity = 64/177 (36.16%), Postives = 88/177 (49.72%), Query Frame = 3
Query:  114 IATLSIXRPEGLKPTDKXSSK-KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            I+T+S+   E    T         VLSVA+S DG+R+A GS D T  ++D         LEGH      + +SP   RV  S S D  + I DA   +    + GH   V SV  SPDG  + +GS D T+K+WD       Q++  H   V  V+F P G RV S S DK+I +++
Sbjct:  820 ISTISVVEAEWNACTQTLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDRERVA-SGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWD 995          

HSP 5 Score: 101.679 bits (252), Expect = 6.152e-21
Identity = 68/186 (36.56%), Postives = 93/186 (50.00%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K+WDTA+     TL     EG   +        V SVA+SPDG+R+A GS D T  ++D         LEGH    + +V+SP   RV  S S D  + I DA   +    + GH   V SV  SPDG  + +GS D T+K+WD       Q++  H   V  V+F P G RV S S D +I +++
Sbjct:  992 KIWDTASGTCTQTL-----EGHGGS--------VWSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVA-SGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWD 1163          

HSP 6 Score: 92.8189 bits (229), Expect = 2.858e-18
Identity = 54/154 (35.06%), Postives = 75/154 (48.70%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSM 545
            K+WD A+     TL                  +V SVA+SPDG+R+A GS+DGT  ++D         LEGH    + + +SP   RV  S S D  + I D    +    + GH  WV SV  SPDG  + +GSSD T+K+WD       Q++
Sbjct: 1118 KIWDAASGTCTQTLE-------------GHGGWVHSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVQSVAFSPDGQRVA-SGSSDKTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTL 1257          

HSP 7 Score: 72.4034 bits (176), Expect = 3.997e-12
Identity = 38/113 (33.63%), Postives = 60/113 (53.10%), Query Frame = 3
Query:  318 LVYSPVDPRV--LFSASXD---THVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            LV++P D  +  +F        + + + +AE  +    + GH   VLSV  S DG  + +GS D+T+K+WD       Q++  H   VW V+F P   RV S SDDK+I +++
Sbjct:  799 LVFAPTDSMIKKIFKKEEPGWISTISVVEAEWNACTQTLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDRERVASGSDDKTIKIWD 911          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WSL17_SCHMA (WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.565e-24
Identity = 56/156 (35.90%), Postives = 92/156 (58.97%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDA-EGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            KFV  +A+  DG ++A G+++G  S+ D+     +  L+GH  P R + +SP D R+L SAS D  + + D  +G+ +  +++GH  WV+SVD + D   + T S+D +V++WDL  +        H DQVW   + P G  ++SV DD+SI +Y+
Sbjct:  146 KFVYXLAYISDGSKLAAGTINGLVSICDLETGS-VQFLDGHATPVRSVSFSP-DGRLLASASDDKQIKVFDVRDGRLVIPSLNGHKGWVVSVDFASDNRHLVTASTDCSVRIWDLASKEEKHCFNTHEDQVWCARYSPQGNNIISVGDDRSIMIYQ 299          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
WDR61_XENTR6.124e-3741.21WD repeat-containing protein 61 OS=Xenopus tropica... [more]
WDR61_DANRE6.124e-3742.17WD repeat-containing protein 61 OS=Danio rerio GN=... [more]
WDR61_XENLA7.998e-3741.76WD repeat-containing protein 61 OS=Xenopus laevis ... [more]
WDR61_HUMAN3.039e-3642.77WD repeat-containing protein 61 OS=Homo sapiens GN... [more]
WDR61_BOVIN3.039e-3642.77WD repeat-containing protein 61 OS=Bos taurus GN=W... [more]
WDR61_RAT3.969e-3642.77WD repeat-containing protein 61 OS=Rattus norvegic... [more]
WDR61_MOUSE3.969e-3642.77WD repeat-containing protein 61 OS=Mus musculus GN... [more]
WDR61_CHICK8.843e-3640.66WD repeat-containing protein 61 OS=Gallus gallus G... [more]
HETE1_PODAN1.848e-2535.98Vegetative incompatibility protein HET-E-1 OS=Podo... [more]
WSL17_SCHMA1.565e-2435.90WD repeat-containing protein SL1-17 OS=Schistosoma... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top