DC900380

Overview
NameDC900380
Unique NameDC900380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3221 contig Csv1_Contig3221:51..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL261_ARATH (60S ribosomal protein L26-1 OS=Arabidopsis thaliana GN=RPL26A PE=2 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 2.552e-52
Identity = 104/144 (72.22%), Postives = 113/144 (78.47%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXTKFTPEDIMQS 486
            MKYNPRV+SSRRKNRKAHFTA SS RR++MS+PLSTDLRQKYNVRSMP+RKDDEVQ+VRGTYKGREGKVVQVYRRKWVIHIERITREKVNG+TVNVGI PSKVVIT                           TKFT ED+MQ+
Sbjct:    1 MKYNPRVTSSRRKNRKAHFTASSSERRVIMSSPLSTDLRQKYNVRSMPIRKDDEVQIVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGTTVNVGIQPSKVVITKLRLDKDRKSLLERKAKGRAAADKEKGTKFTSEDVMQN 144          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL262_ARATH (60S ribosomal protein L26-2 OS=Arabidopsis thaliana GN=RPL26B PE=2 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 9.077e-50
Identity = 99/144 (68.75%), Postives = 112/144 (77.78%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXTKFTPEDIMQS 486
            MK+NPRVSSSRRKNRKAHFTAPSSVRR+LMS+PLS DLR K+NVRSMP+RKDDEVQVVRGT+KGREGKV+QVYRRKWVIHIERITREKVNGSTVNVG+N S V+IT                           TKF+ ED+M++
Sbjct:    1 MKFNPRVSSSRRKNRKAHFTAPSSVRRVLMSSPLSKDLRNKHNVRSMPIRKDDEVQVVRGTFKGREGKVMQVYRRKWVIHIERITREKVNGSTVNVGVNASNVMITKLRLDKDRKSLLERKANGRAAADKEKGTKFSAEDVMEN 144          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_BRARA (60S ribosomal protein L26 OS=Brassica rapa GN=RPL26 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.227e-46
Identity = 94/144 (65.28%), Postives = 107/144 (74.31%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVITXXXXXXXXXXXXXXXXXXXXXXXXXXXTKFTPEDIMQS 486
            MKYNPRV+SSRR+NRK HFTA SS RR+ MS+PLSTDLRQKYNVRSMP+RKDDE Q+VRGTYKGREGK+ QVYRRK VIHIER+TREKVNG+TVNVG+ P+KVVIT                           TKFT  D+MQ+
Sbjct:    1 MKYNPRVTSSRRRNRKPHFTASSSERRVXMSSPLSTDLRQKYNVRSMPIRKDDEXQIVRGTYKGREGKLXQVYRRKXVIHIERLTREKVNGTTVNVGVQPTKVVITKLRLDKDRKSLLERKAKGRAAADKDKGTKFTAVDVMQN 144          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26L_HUMAN (60S ribosomal protein L26-like 1 OS=Homo sapiens GN=RPL26L1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.520e-39
Identity = 80/107 (74.77%), Postives = 95/107 (88.79%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK+NP V+S R KNRK HF APS VRR +MS+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI+PSKVVIT
Sbjct:    1 MKFNPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_MOUSE (60S ribosomal protein L26 OS=Mus musculus GN=Rpl26 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.209e-39
Identity = 79/107 (73.83%), Postives = 95/107 (88.79%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK+NP V+S R KNRK HF APS +RR +MS+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI+PSKVVIT
Sbjct:    1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_MACFA (60S ribosomal protein L26 OS=Macaca fascicularis GN=RPL26 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.209e-39
Identity = 79/107 (73.83%), Postives = 95/107 (88.79%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK+NP V+S R KNRK HF APS +RR +MS+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI+PSKVVIT
Sbjct:    1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_HUMAN (60S ribosomal protein L26 OS=Homo sapiens GN=RPL26 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.209e-39
Identity = 79/107 (73.83%), Postives = 95/107 (88.79%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK+NP V+S R KNRK HF APS +RR +MS+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI+PSKVVIT
Sbjct:    1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_BOVIN (60S ribosomal protein L26 OS=Bos taurus GN=RPL26 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 7.209e-39
Identity = 79/107 (73.83%), Postives = 95/107 (88.79%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK+NP V+S R KNRK HF APS +RR +MS+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI+PSKVVIT
Sbjct:    1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_RAT (60S ribosomal protein L26 OS=Rattus norvegicus GN=Rpl26 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 9.415e-39
Identity = 79/107 (73.83%), Postives = 94/107 (87.85%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK+NP V+S R KNRK HF APS +RR +MS+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI PSKVVIT
Sbjct:    1 MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIRPSKVVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_AILME (60S ribosomal protein L26 OS=Ailuropoda melanoleuca GN=RPL26 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.151e-36
Identity = 77/107 (71.96%), Postives = 92/107 (85.98%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK  P V+S R KNRK HF APS +RR  +S+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI+PSKVVIT
Sbjct:    1 MKSYPFVTSDRSKNRKRHFNAPSHIRRKTLSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 107          
The following BLAST results are available for this feature:
BLAST of DC900380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
RL261_ARATH2.552e-5272.2260S ribosomal protein L26-1 OS=Arabidopsis thalian... [more]
RL262_ARATH9.077e-5068.7560S ribosomal protein L26-2 OS=Arabidopsis thalian... [more]
RL26_BRARA1.227e-4665.2860S ribosomal protein L26 OS=Brassica rapa GN=RPL2... [more]
RL26L_HUMAN5.520e-3974.7760S ribosomal protein L26-like 1 OS=Homo sapiens G... [more]
RL26_MOUSE7.209e-3973.8360S ribosomal protein L26 OS=Mus musculus GN=Rpl26... [more]
RL26_MACFA7.209e-3973.8360S ribosomal protein L26 OS=Macaca fascicularis G... [more]
RL26_HUMAN7.209e-3973.8360S ribosomal protein L26 OS=Homo sapiens GN=RPL26... [more]
RL26_BOVIN7.209e-3973.8360S ribosomal protein L26 OS=Bos taurus GN=RPL26 P... [more]
RL26_RAT9.415e-3973.8360S ribosomal protein L26 OS=Rattus norvegicus GN=... [more]
RL26_AILME1.151e-3671.9660S ribosomal protein L26 OS=Ailuropoda melanoleuc... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900380 VSS Citrus sinensis cDNA clone VS28952 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900380 ID=DC900380|Name=DC900380|organism=Citrus sinensis|type=EST|length=695bp
CTTCCTCTAGCTGCCGCTGTTGTAAAACCCTAGGCCCAGTCCTCCACATC
CACCATGAAGTACAACCCCAGGGTGTCATCCTCTCGCCGTAAGAACCGGA
AGGCGCACTTCACCGCCCCTTCCAGCGTGCGCCGCATCTTGATGAGCGCG
CCGCTGTCCACTGACCTCCGTCAGAAGTACAACGTAAGGTCGATGCCTGT
GCGCAAGGACGACGAGGTCCAGGTTGTCCGTGGGACCTACAAGGGGCGCG
AGGGCAAAGTCGTTCAAGTGTATCGCCGGAAGTGGGTCATTCACATCGAG
CGCATCACTCGCGAGAAGGTTAATGGATCCACTGTGAATGTGGGAATCAA
CCCATCAAAGGTCGTGATCACCAAGCTCCGTCTGGACAAGGACAGGAAGT
CTTTGCTCGATCGCAAGGCCAAGGGACGTGCCGCCGCTGACAAGGAGAAG
GGTACCAAGTTCACCCCAGAGGATATTATGCAGAGTGTTGACTAATTTTT
ATAAGAGGTTGTTTTTAAAGTTTTTGTTTAATCATAGATTTTATGGATTT
AGGATGTTTTGTTTTGGCAATGTCCCTAAGATATTTCTATTGTTATTGTG
TTATGCCNTGAGGATCCGATTATGGGCTTATGTTGGAGATTTAAGATACT
TCTTTGGATTTTCTCCNCGTCGTTTCNATTTTAATTCTATATTTT
back to top