DC900379

Overview
NameDC900379
Unique NameDC900379
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length434
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1841 contig Csv1_Contig1841:649..1082. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900379 vs. ExPASy Swiss-Prot
Match: OLP1_SOLLC (Osmotin-like protein OS=Solanum lycopersicum PE=1 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 3.343e-20
Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 2
Query:    5 SPQTCRASSFSEFFKHACPATMTYAHDSPSLMHDCSSPRELKVIFCH 145
            SPQTC+ SS+S+FFKHACPAT TYAHDSPSLMH+CSSPRELKVIFCH
Sbjct:  206 SPQTCKPSSYSQFFKHACPATFTYAHDSPSLMHECSSPRELKVIFCH 252          
The following BLAST results are available for this feature:
BLAST of DC900379 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
OLP1_SOLLC3.343e-2087.23Osmotin-like protein OS=Solanum lycopersicum PE=1 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900379 VSS Citrus sinensis cDNA clone VS28951 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900379 ID=DC900379|Name=DC900379|organism=Citrus sinensis|type=EST|length=434bp
CACCAGTCCGCAGACATGCCGGGCTTCGAGCTTTTCGGAGTTCTTCAAGC
ACGCTTGTCCAGCCACGATGACTTATGCCCATGACAGCCCTTCGCTCATG
CATGACTGCTCCTCGCCACGTGAGCTAAAAGTTATTTTCTGTCACTAGAG
AAGCATGAGAATAATAATAAGCTGGAGCATCAAGCTTCACAGTGCTTAGG
ATTGTTGTGTTTGTTTTCGTCAATTAGCAGTATCTTGCTTTTTAATTAAT
CTCGTAACTAAAAAGAGAAATTAAAAATGATCAATGTGAGCTTGTGTCAT
GTTGGGTGTCATCAGTCTGTACGTTGTGGTGTGTTTTGTAAGTTCCAATT
CAATTTGGAATGGGAATGTAATGAGTTTGATGTGTGGTATATTTTCTTTT
TTCATGAAAAAGTAAAATAGAAATTATTTTTCTT
back to top