DC900378

Overview
NameDC900378
Unique NameDC900378
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length546
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900378_ssr1 microsatellite DC900378_ssr1:1..24. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig978 contig Csv1_Contig978:5..550. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: PH1_ARATH (Pleckstrin homology domain-containing protein 1 OS=Arabidopsis thaliana GN=PH1 PE=2 SV=2)

HSP 1 Score: 244.202 bits (622), Expect = 3.063e-64
Identity = 112/144 (77.78%), Postives = 128/144 (88.89%), Query Frame = 1
Query:   76 MENIWRALSGQDPNPEDYTGIEFWSNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNI-TPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFELSTGEYTMYFVADTEKEKEEWINSIGRAIVQHSRSVTESEVVDYDNK 504
            ME+IWR  +GQDP+ EDY GIEFWSNPERSGWLTKQGDYIKTWRRRWF+LK+GKL WFKD       GSTPRGVI VG CLTV+GAED++NKPFAFELS+G YTM+F+AD EKEKEEWINSIGR+IVQHSRSVT+SEV+DYD++
Sbjct:    1 MESIWRIATGQDPSREDYEGIEFWSNPERSGWLTKQGDYIKTWRRRWFVLKRGKLLWFKDQAAAGIRGSTPRGVISVGDCLTVKGAEDVVNKPFAFELSSGSYTMFFIADNEKEKEEWINSIGRSIVQHSRSVTDSEVLDYDHR 144          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: Y4775_DICDI (PH domain-containing protein DDB_G0274775 OS=Dictyostelium discoideum GN=DDB_G0274775 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.214e-13
Identity = 41/110 (37.27%), Postives = 60/110 (54.55%), Query Frame = 1
Query:  118 PEDYTGIEFWSNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDL-LNKPFAFELSTGEYTMYFVADTEKEKEEWINSIGR 444
            PE    +   +  +R GWLTKQG  I+TWRRRWF+LK  KLF+FK   +I       G+I +     V+  +D    K + F + T +   Y  A+TE + ++W+ SI R
Sbjct:    4 PELKVSVSQLAPSDREGWLTKQGGSIRTWRRRWFVLKGKKLFYFKSKGDI----EATGLIELEQNSFVKEEKDKDKKKKYMFTVGTSKRVFYIFAETETDMKQWMESIKR 109          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH2_CERAE (Cytohesin-2 OS=Cercopithecus aethiops GN=CYTH2 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.083e-12
Identity = 45/122 (36.89%), Postives = 63/122 (51.64%), Query Frame = 1
Query:  151 NPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G  +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  +D   KP  FEL                       G + +Y + A T++EK+EWI SI  A+
Sbjct:  259 NPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVDD-PRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAV 374          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH3_MOUSE (Cytohesin-3 OS=Mus musculus GN=Cyth3 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.062e-12
Identity = 45/122 (36.89%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  151 NPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFELST---------------------GEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G  +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  ED   KP  FEL                       G + +Y + A + +EKEEW+ SI  +I
Sbjct:  264 NPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVED-PRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASI 379          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH1_HUMAN (Cytohesin-1 OS=Homo sapiens GN=CYTH1 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.034e-11
Identity = 48/123 (39.02%), Postives = 62/123 (50.41%), Query Frame = 1
Query:  151 NPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G   +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  ED   KP  FEL                       G +T+Y + A T +EKEEWI  I  AI
Sbjct:  260 NPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVED-SKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAI 376          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH1_CERAE (Cytohesin-1 OS=Cercopithecus aethiops GN=CYTH1 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.034e-11
Identity = 48/123 (39.02%), Postives = 62/123 (50.41%), Query Frame = 1
Query:  151 NPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G   +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  ED   KP  FEL                       G +T+Y + A T +EKEEWI  I  AI
Sbjct:  260 NPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVED-SKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAI 376          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH1_RAT (Cytohesin-1 OS=Rattus norvegicus GN=Cyth1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.303e-11
Identity = 47/123 (38.21%), Postives = 62/123 (50.41%), Query Frame = 1
Query:  151 NPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G   +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  ED   KP  FEL                       G +T+Y + A T +EKE+WI  I  AI
Sbjct:  260 NPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVED-SKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEDWIKCIKAAI 376          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH1_MOUSE (Cytohesin-1 OS=Mus musculus GN=Cyth1 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 2.303e-11
Identity = 47/123 (38.21%), Postives = 62/123 (50.41%), Query Frame = 1
Query:  151 NPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G   +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  ED   KP  FEL                       G +T+Y + A T +EKE+WI  I  AI
Sbjct:  260 NPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVED-SKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEDWIKCIKAAI 376          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH4_HUMAN (Cytohesin-4 OS=Homo sapiens GN=CYTH4 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.131e-11
Identity = 42/124 (33.87%), Postives = 63/124 (50.81%), Query Frame = 1
Query:  151 NPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFELST---------------------GEYTMYFVADTE-KEKEEWINSIGRAIVQ 456
            NP+R GWL K G  +KTW+RRWFIL    L++F+     T    PRG+IP+   L+V+  +D   KPF  EL                       G++  Y ++ T  +E+++WI SI  +I +
Sbjct:  259 NPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFE----FTTDKEPRGIIPLEN-LSVQKVDD-PKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASITR 376          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH2_RAT (Cytohesin-2 OS=Rattus norvegicus GN=Cyth2 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.131e-11
Identity = 45/123 (36.59%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  151 NPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G   +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  +D   KP  FEL                       G + +Y + A T++EK+EWI SI  A+
Sbjct:  259 NPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVDD-PRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAV 375          
The following BLAST results are available for this feature:
BLAST of DC900378 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
PH1_ARATH3.063e-6477.78Pleckstrin homology domain-containing protein 1 OS... [more]
Y4775_DICDI3.214e-1337.27PH domain-containing protein DDB_G0274775 OS=Dicty... [more]
CYH2_CERAE2.083e-1236.89Cytohesin-2 OS=Cercopithecus aethiops GN=CYTH2 PE=... [more]
CYH3_MOUSE6.062e-1236.89Cytohesin-3 OS=Mus musculus GN=Cyth3 PE=1 SV=1[more]
CYH1_HUMAN1.034e-1139.02Cytohesin-1 OS=Homo sapiens GN=CYTH1 PE=1 SV=1[more]
CYH1_CERAE1.034e-1139.02Cytohesin-1 OS=Cercopithecus aethiops GN=CYTH1 PE=... [more]
CYH1_RAT2.303e-1138.21Cytohesin-1 OS=Rattus norvegicus GN=Cyth1 PE=1 SV=... [more]
CYH1_MOUSE2.303e-1138.21Cytohesin-1 OS=Mus musculus GN=Cyth1 PE=1 SV=1[more]
CYH4_HUMAN5.131e-1133.87Cytohesin-4 OS=Homo sapiens GN=CYTH4 PE=1 SV=1[more]
CYH2_RAT5.131e-1136.59Cytohesin-2 OS=Rattus norvegicus GN=Cyth2 PE=1 SV=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900378 VSS Citrus sinensis cDNA clone VS28950 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900378 ID=DC900378|Name=DC900378|organism=Citrus sinensis|type=EST|length=546bp
CTCTCTCTCTCTCTCTCTCTCTCTCGCACAAAAGAAAAGACGACTGCCAA
TTGAGTAGAAAGTGCTTCAACTTCAATGGAGAATATCTGGCGTGCCTTGT
CGGGTCAGGACCCGAACCCGGAAGATTACACAGGCATAGAGTTCTGGTCT
AACCCGGAGCGATCGGGCTGGTTAACAAAGCAAGGCGACTACATCAAAAC
GTGGCGCCGCCGTTGGTTCATTCTGAAACAAGGCAAGCTCTTTTGGTTCA
AAGACTCCCACAACATCACCCCCGGCTCCACTCCACGTGGCGTCATCCCT
GTGGGCACTTGCCTCACCGTCAGGGGCGCCGAGGACCTTCTGAACAAACC
CTTCGCCTTCGAGCTCTCCACGGGGGAATACACGATGTACTTTGTGGCGG
ATACTGAGAAGGAGAAAGAGGAGTGGATCAATTCGATTGGCCGCGCGATT
GTTCAGCACTCGCGCTCGGTGACTGAATCCGAAGTCGTTGATTATGATAA
CAAATGATGATTGGTTTGTGAAATTTTCAATTTCTTAAATTTACTG
back to top