DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_HEVBR (Translationally-controlled tumor protein homolog OS=Hevea brasiliensis GN=TCTP PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.844e-75
Identity = 143/168 (85.12%), Postives = 145/168 (86.31%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSFPYKEI NGILWEVEGKWVVQGAVDVDIGANPS               KVVDIVDTFRLQEQPAFDKK FVTYMKRFIKLLTPKL EE+QE FKKNIEGATKFLLSKLSDLQFFVGESMHDDG LVFAYY+ GATDPTFLY A ALKEVKC
Sbjct:    1 MLVYQDLLTGDELLSDSFPYKEIHNGILWEVEGKWVVQGAVDVDIGANPSAEGADEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYMKRFIKLLTPKLDEEKQESFKKNIEGATKFLLSKLSDLQFFVGESMHDDGSLVFAYYRGGATDPTFLYFAYALKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_ELAGV (Translationally-controlled tumor protein homolog OS=Elaeis guineensis var. tenera GN=TCTP PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.254e-73
Identity = 135/168 (80.36%), Postives = 145/168 (86.31%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSFPYKEI NG+LWEVEGKWV+QGAV+VDIGANPS               KVVDIVDTFRLQEQPAFDKK FVT+MKR+IK LTPKL  E+QE+FKK+IEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYK+GATDPTFLY A  LKE+KC
Sbjct:    1 MLVYQDLLTGDELLSDSFPYKEIHNGMLWEVEGKWVIQGAVNVDIGANPSAEGGEEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTFMKRYIKNLTPKLDAEKQELFKKHIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKDGATDPTFLYFAYGLKEIKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CUCMA (Translationally-controlled tumor protein homolog OS=Cucurbita maxima GN=TCTP PE=2 SV=1)

HSP 1 Score: 268.855 bits (686), Expect = 2.110e-71
Identity = 130/168 (77.38%), Postives = 141/168 (83.93%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSFPYKE+ENG++WEVEGKWVVQGAVDVDIGANPS               KVVDIVDTFRLQEQP  DKK F+ Y+K+FIKLLTPKL  E+QE FKKNIEGATKFLL KL D +FFVGESMHDD C+VFAYY+EGATDPTFLY+A ALKEVKC
Sbjct:    1 MLVYQDLLTGDELLSDSFPYKELENGMIWEVEGKWVVQGAVDVDIGANPSAEGDGEDEGVDDQAVKVVDIVDTFRLQEQPTMDKKQFIAYIKKFIKLLTPKLEGEKQEAFKKNIEGATKFLLPKLKDFRFFVGESMHDDSCIVFAYYREGATDPTFLYLAPALKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_SOYBN (Translationally-controlled tumor protein homolog OS=Glycine max GN=TCTP PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 5.196e-70
Identity = 132/168 (78.57%), Postives = 141/168 (83.93%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSF YKEIENG+LWEVEGKWVV+GAVDVDIGANPS               KVVDIVDTFRLQEQPAFDKK FVT+MKRFIK LTPKL  E+QE+FKK+IEGATK+LLSK+ D QFFVGESM DD CLVFAYYK+GA DPTFLY A ALKEVKC
Sbjct:    1 MLVYQDLLTGDELLSDSFRYKEIENGMLWEVEGKWVVKGAVDVDIGANPSAEGGGEDEGVDDAAVKVVDIVDTFRLQEQPAFDKKQFVTFMKRFIKNLTPKLDAEQQELFKKHIEGATKYLLSKIKDFQFFVGESMGDDACLVFAYYKDGAADPTFLYFAYALKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_ORYSJ (Translationally-controlled tumor protein homolog OS=Oryza sativa subsp. japonica GN=TCTP PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.512e-69
Identity = 130/168 (77.38%), Postives = 140/168 (83.33%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSFPY+EIENGILWEV+GKWVVQGA+DVDIGANPS               KVVDIVDTFRLQEQP FDKK FVT+MKR+IK L+ KL  E+QE FKKNIEGATK+LL KL DLQFFVGESMHDDG LVFAYYK+GATDPTFLY +  LKEVKC
Sbjct:    1 MLVYQDLLTGDELLSDSFPYREIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGVDDQAVKVVDIVDTFRLQEQPPFDKKQFVTFMKRYIKNLSAKLDAEKQEEFKKNIEGATKYLLGKLKDLQFFVGESMHDDGGLVFAYYKDGATDPTFLYFSHGLKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_SOLLC (Translationally-controlled tumor protein homolog OS=Solanum lycopersicum GN=TCTP PE=2 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.975e-69
Identity = 128/168 (76.19%), Postives = 139/168 (82.74%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSFPYKE+ENG+LWEV+GKWVVQGAVDV+IGANPS               +VVDIVDTFRLQEQPAFDKK FVT+MKR+IK LTPKL  E QE FKKNIE ATKFLL K+ DLQFFVGESMHDDG LVFAYYKEG+ DP FLY+A  LKE+KC
Sbjct:    1 MLVYQDLLTGDELLSDSFPYKEVENGVLWEVQGKWVVQGAVDVNIGANPSAEGGCEDEGVDDQAVRVVDIVDTFRLQEQPAFDKKQFVTFMKRYIKNLTPKLEGETQEAFKKNIEAATKFLLQKIKDLQFFVGESMHDDGALVFAYYKEGSADPPFLYIAPGLKEIKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_SOLTU (Translationally-controlled tumor protein homolog OS=Solanum tuberosum GN=TCTP PE=2 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 7.503e-69
Identity = 128/168 (76.19%), Postives = 138/168 (82.14%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSFPYKEI+NG+LWEV+GKWVVQGAVDV+IGANPS               KVVDIVDTFRLQEQPAFDKK FVTY+KR+IK LTPKL  E QE FKKNIE ATKFLLSKL D QFFVGE MHDD  LVFAYYK+G+ DPTFLY+A  LKE+KC
Sbjct:    1 MLVYQDLLTGDELLSDSFPYKEIQNGMLWEVQGKWVVQGAVDVNIGANPSAEGGGEDEGVDDQAVKVVDIVDTFRLQEQPAFDKKQFVTYIKRYIKNLTPKLEGEAQEAFKKNIESATKFLLSKLKDFQFFVGEGMHDDSALVFAYYKDGSADPTFLYLAPGLKEIKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_ARATH (Translationally-controlled tumor protein homolog OS=Arabidopsis thaliana GN=TCTP PE=1 SV=2)

HSP 1 Score: 257.684 bits (657), Expect = 4.863e-68
Identity = 127/168 (75.60%), Postives = 137/168 (81.55%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWV  GAVDV+IGANPS               KVVDIVDTFRLQEQP +DKK F+ Y+K++IKLLTPKLSEE Q +FKK IEGATKFLL +LSD QFFVGE MHDD  LVFAYYKEG+T+PTFLY A  LKEVKC
Sbjct:    1 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVTVGAVDVNIGANPSAEEGGEDEGVDDSTQKVVDIVDTFRLQEQPTYDKKGFIAYIKKYIKLLTPKLSEEDQAVFKKGIEGATKFLLPRLSDFQFFVGEGMHDDSTLVFAYYKEGSTNPTFLYFAHGLKEVKC 168          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_FRAAN (Translationally-controlled tumor protein homolog OS=Fragaria ananassa GN=TCTP PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 2.414e-67
Identity = 131/170 (77.06%), Postives = 140/170 (82.35%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXX--KVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            MLVYQDLL+GDELLSDSFPYKEI+NG+LWEV+GKWVVQGAVDVDIGANPS                 KVVDIVDTFRLQEQP FDKK FVT++KR+IKLLTPKL  E+QE FKKNIEGATKFLLSKLSDLQFFVGESM DD  LVFA YKEGATDP F+Y A  LKEVKC
Sbjct:    1 MLVYQDLLSGDELLSDSFPYKEIQNGVLWEVDGKWVVQGAVDVDIGANPSAEGADADADEGVDDQTVKVVDIVDTFRLQEQPPFDKKQFVTWVKRYIKLLTPKLEGEQQETFKKNIEGATKFLLSKLSDLQFFVGESMGDDTSLVFASYKEGATDPIFIYFAHGLKEVKC 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PSEMZ (Translationally-controlled tumor protein homolog OS=Pseudotsuga menziesii GN=TCTP PE=2 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 5.377e-67
Identity = 127/168 (75.60%), Postives = 139/168 (82.74%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M+VYQDLL+GDELLSDSFPYKE+ NG+LWEVEGKWVVQGAVDVDIGANPS               KVVDIVDTFRLQEQP FDKK F+ ++KR+IK L  KLSEERQ  FKKN+EGA K L+SKLSDLQFFVGESMHDDG +VFAYYK+GATDPTFLY AD LKEVKC
Sbjct:    1 MIVYQDLLSGDELLSDSFPYKELYNGVLWEVEGKWVVQGAVDVDIGANPSAEGGDEEGVKIRLV-KVVDIVDTFRLQEQPPFDKKQFLGFIKRYIKNLATKLSEERQAEFKKNVEGAAKMLVSKLSDLQFFVGESMHDDGSMVFAYYKDGATDPTFLYFADGLKEVKC 167          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_HEVBR1.844e-7585.12Translationally-controlled tumor protein homolog O... [more]
TCTP_ELAGV2.254e-7380.36Translationally-controlled tumor protein homolog O... [more]
TCTP_CUCMA2.110e-7177.38Translationally-controlled tumor protein homolog O... [more]
TCTP_SOYBN5.196e-7078.57Translationally-controlled tumor protein homolog O... [more]
TCTP_ORYSJ1.512e-6977.38Translationally-controlled tumor protein homolog O... [more]
TCTP_SOLLC1.975e-6976.19Translationally-controlled tumor protein homolog O... [more]
TCTP_SOLTU7.503e-6976.19Translationally-controlled tumor protein homolog O... [more]
TCTP_ARATH4.863e-6875.60Translationally-controlled tumor protein homolog O... [more]
TCTP_FRAAN2.414e-6777.06Translationally-controlled tumor protein homolog O... [more]
TCTP_PSEMZ5.377e-6775.60Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top