DC900365

Overview
NameDC900365
Unique NameDC900365
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length609
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10161 contig Csv1_Contig10161:68..676. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: BX42_DROME (Puff-specific protein Bx42 OS=Drosophila melanogaster GN=Bx42 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.429e-34
Identity = 82/170 (48.24%), Postives = 108/170 (63.53%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRFKPDKGFAGSSER--SGPRDRPVEFEKEAEEADPFGLDEFLTEVEKGGKKALDK 506
            +RER+R    + AA  K+SK+ ++R+RDISE+ ALG+ +  A  G E  F QRLFN  KGMDSG+  D+ YNVYDK    +    + +YRP K AD D YGG+ D     I+ T RF PDK F+G+S+   +G R  PVEFEK   E DPFGLD+FL   +K  K+A +K
Sbjct:  370 QRERQRDRNLQRAAPEKRSKLQKERERDISEQIALGLPAKSAGNG-ETLFDQRLFNTTKGMDSGYGDDEAYNVYDKPWRDSNTLGAHIYRPSKQADSDNYGGDLD----AIVNTKRFVPDKQFSGASKEAAAGQRSGPVEFEK---EEDPFGLDQFLNMAKKAPKRAEEK 531          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: SNW1_PONAB (SNW domain-containing protein 1 OS=Pongo abelii GN=SNW1 PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 4.757e-30
Identity = 78/167 (46.71%), Postives = 105/167 (62.87%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFA--TDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRFKPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEVEK-GGKK 494
            ER+ +R L    AA  K+SK+ R+ +RDISE  ALG+ +   +   EV + QRLFNQ KGMDSGFA   D+ YNVYD+     +    ++YRP K+ D DMYG    + +E  +KT+RF PDK F+GS  R   R+ PV+FE+     DPFGLD+FL E ++ GG K
Sbjct:  362 ERQHDRNLSR--AAPDKRSKLQRNENRDISEVIALGVPNPRTSN--EVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYG----DDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEE-----DPFGLDKFLEEAKQHGGSK 515          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: SNW1_HUMAN (SNW domain-containing protein 1 OS=Homo sapiens GN=SNW1 PE=1 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 4.757e-30
Identity = 78/167 (46.71%), Postives = 105/167 (62.87%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFA--TDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRFKPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEVEK-GGKK 494
            ER+ +R L    AA  K+SK+ R+ +RDISE  ALG+ +   +   EV + QRLFNQ KGMDSGFA   D+ YNVYD+     +    ++YRP K+ D DMYG    + +E  +KT+RF PDK F+GS  R   R+ PV+FE+     DPFGLD+FL E ++ GG K
Sbjct:  362 ERQHDRNLSR--AAPDKRSKLQRNENRDISEVIALGVPNPRTSN--EVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYG----DDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEE-----DPFGLDKFLEEAKQHGGSK 515          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: SNW1_BOVIN (SNW domain-containing protein 1 OS=Bos taurus GN=SNW1 PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 6.212e-30
Identity = 78/167 (46.71%), Postives = 104/167 (62.28%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFA--TDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRFKPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEVEK-GGKK 494
            ER+ +R L    AA  K+SK+ R+ +RDISE  ALG+ +   +   EV + QRLFNQ KGMDSGFA   D+ YNVYD+     +     +YRP K+ D DMYG    + +E  +KT+RF PDK F+GS  R   R+ PV+FE+     DPFGLD+FL E ++ GG K
Sbjct:  362 ERQHDRNLSR--AAPDKRSKLQRNENRDISEVIALGVPNPRTSN--EVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQNIYRPSKNLDKDMYG----DDLEARIKTNRFVPDKEFSGSDRRQRGREGPVQFEE-----DPFGLDKFLEEAKQHGGSK 515          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: SNW1_MOUSE (SNW domain-containing protein 1 OS=Mus musculus GN=Snw1 PE=1 SV=3)

HSP 1 Score: 129.798 bits (325), Expect = 1.060e-29
Identity = 77/167 (46.11%), Postives = 105/167 (62.87%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFA--TDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRFKPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEVEK-GGKK 494
            ER+ +R L    AA  K+SK+ R+ +RDISE  ALG+ +   +   EV + QRLFNQ KGMDSGFA   D+ YNVYD+     +    ++YRP K+ D DMYG    + +E  +KT+RF PDK F+GS  +   R+ PV+FE+     DPFGLD+FL E ++ GG K
Sbjct:  362 ERQHDRNLSR--AAPDKRSKLQRNENRDISEVIALGVPNPRTSN--EVQYDQRLFNQSKGMDSGFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYG----DDLEARIKTNRFVPDKEFSGSDRKQRGREGPVQFEE-----DPFGLDKFLEEAKQHGGSK 515          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: PRP45_CRYNE (Pre-mRNA-processing protein 45 OS=Cryptococcus neoformans GN=PRP45 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.341e-24
Identity = 65/179 (36.31%), Postives = 105/179 (58.66%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSK---ITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPK-KDADDDMYGGNADEQMEKIMKTDRFK---PDKGFAGSSERSGPRDRPVEFEKEA-----EEADPFGLDEFLTEVEKGGKKALD 503
            E+ RER  E + + MG + +   + ++ +RDISEK ALG+A   A++  E     RLFN+E  + +GFA++D YN+YDK LF      + +YRP     +D+ +GG  +E +++ M  DRF+     +GF G +E    R+ PV+FEK+        ADPFG+++F+    +GGK+  +
Sbjct:  407 EKRREREKEMRMSNMGSEMRAKMLAKEANRDISEKIALGLAKPSASK--ETLLDSRLFNRE-ALSTGFASEDSYNLYDKPLFAGSSAAAAIYRPAGSSRNDESFGGGTEEGIKEEMSKDRFQLGNATRGFEG-AEGVEAREGPVQFEKDTIVALDGSADPFGVEQFMDAARRGGKRTAE 581          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: SNWA_DICDI (Protein snwA OS=Dictyostelium discoideum GN=snwA PE=1 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.751e-24
Identity = 72/167 (43.11%), Postives = 97/167 (58.08%), Query Frame = 3
Query:    3 ERERERRLEAKDAAMGKKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRF------------KPDKGFAGSSERSGPRDRPVEFEKEAEEA-DPFGLDEF 464
            E ERE RLEA     GKKSK  RD+DRDISEK ALG AS    R  +  + QRLFNQ + + SGF  DD YNVY K LF    + +++YRPK + +D       +  ++ ++   RF            +P+K F+G ++RS  R  PV FEKE +++ DPFG D+F
Sbjct:  530 ELEREYRLEAS----GKKSKFNRDQDRDISEKIALGQASI--KRTEDSIYDQRLFNQSESLTSGFGNDDSYNVYSKPLFGGAVS-NSIYRPKSNQED-------NTSIQDVLSNSRFGKEGGSGSGGVPRPNKEFSG-TDRSKDRTGPVAFEKEKKKSDDPFGFDDF 681          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: YGH1_CAEEL (Uncharacterized protein T27F2.1 OS=Caenorhabditis elegans GN=T27F2.1 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 2.287e-24
Identity = 70/169 (41.42%), Postives = 94/169 (55.62%), Query Frame = 3
Query:   51 KKSKITRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRFKPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEVEKGGKKALDKVGTGGTMRASAGSSMRD 557
            K  K+ ++R+RDISEK  LG+  T   R GE  F QRLF++ +G+DSG   DD YN YD            +YRP K+ D+D+YGG+ D+ +E   + +RF  DKGF+G +E S     PV+FEK   + D FGL   L E  K  K+     G GG  R  +  S RD
Sbjct:  379 KADKLRKERERDISEKIVLGLPDTNQKRTGEPQFDQRLFDKTQGLDSGAMDDDTYNPYDAAWRGGDSVQQHVYRPSKNLDNDVYGGDLDKIIE---QKNRFVADKGFSG-AEGSSRGSGPVQFEK---DQDVFGLSS-LFEHTKEKKRG----GDGGDSRGESKRSRRD 535          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: PRP45_ASPFU (Pre-mRNA-processing protein 45 OS=Aspergillus fumigatus GN=prp45 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.482e-23
Identity = 82/209 (39.23%), Postives = 111/209 (53.11%), Query Frame = 3
Query:    3 ERERERRLEAKDAA-------MGKKSKI---TRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRF----KPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEVEKGGKKALDKVGTGGTMRASAGSSMRDDYGGSGRSRI 587
            ERER RR   +DA        MG + +I    R+++RDISEK ALG+A     +  E  +  RLFNQ  G+ SGF  D   N YDK LF AQ  ++++YRP+   D D   G A+ +M KI KT+RF    K  +GF G++E    RD PV+FEK+    DPFG+D  + +V           G  G  R       R+D  GS R+R+
Sbjct:  388 ERERIRRERRQDAERQLRQSRMGTERRIQMMAREQNRDISEKVALGLAKP--TQTSESMWDSRLFNQTSGLQSGFNED---NPYDKPLFAAQDAINSIYRPRAQLDVDDEEG-AEGEMSKIQKTNRFEVLGKAKEGFRGAAEAEA-RDGPVQFEKDT--TDPFGIDSMIADV----------TGGAGQKRYGIQEVERED-RGSKRARV 576          
BLAST of DC900365 vs. ExPASy Swiss-Prot
Match: PRP45_EMENI (Pre-mRNA-processing protein 45 OS=Emericella nidulans GN=prp45 PE=3 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 5.632e-23
Identity = 80/212 (37.74%), Postives = 113/212 (53.30%), Query Frame = 3
Query:    3 ERERERRLEAKDAA-------MGKKSKI---TRDRDRDISEKFALGMASTGAARGGEVTFXQRLFNQEKGMDSGFATDDQYNVYDKGLFTAQPTLSTLYRPKKDADDDMYGGNADEQMEKIMKTDRF----KPDKGFAGSSERSGPRDRPVEFEKEAEEADPFGLDEFLTEVEKGGKKALDKVGTGGTMRASAGSSMRDDYGGSGRSRIGFE 596
            ERER RR   +DA        MG + +I    R+++RDISEK ALG+A     +  E  +  RLFNQ  G+ +GF  D   N YDK LF AQ  ++++YRPK  AD D    +A+ +M KI K++RF    +  +GF G+++ +  R  PV+FEK+   ADPFG+D  + +V  G        G  G  R         D  GS R+R+  E
Sbjct:  388 ERERIRRERRQDAERQLRQSRMGTERRIQAMAREQNRDISEKVALGLAKP--TQSSETMWDSRLFNQTSGLSTGFNED---NPYDKPLFAAQDAINSIYRPKPQADFD-DEADAEGEMSKIQKSNRFEVLGRAKEGFRGAAD-AEERSGPVQFEKDT--ADPFGIDSMIADVTGG-------AGGAGQKRYGI-QEAEPDSRGSKRARVDEE 582          
The following BLAST results are available for this feature:
BLAST of DC900365 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
BX42_DROME1.429e-3448.24Puff-specific protein Bx42 OS=Drosophila melanogas... [more]
SNW1_PONAB4.757e-3046.71SNW domain-containing protein 1 OS=Pongo abelii GN... [more]
SNW1_HUMAN4.757e-3046.71SNW domain-containing protein 1 OS=Homo sapiens GN... [more]
SNW1_BOVIN6.212e-3046.71SNW domain-containing protein 1 OS=Bos taurus GN=S... [more]
SNW1_MOUSE1.060e-2946.11SNW domain-containing protein 1 OS=Mus musculus GN... [more]
PRP45_CRYNE1.341e-2436.31Pre-mRNA-processing protein 45 OS=Cryptococcus neo... [more]
SNWA_DICDI1.751e-2443.11Protein snwA OS=Dictyostelium discoideum GN=snwA P... [more]
YGH1_CAEEL2.287e-2441.42Uncharacterized protein T27F2.1 OS=Caenorhabditis ... [more]
PRP45_ASPFU1.482e-2339.23Pre-mRNA-processing protein 45 OS=Aspergillus fumi... [more]
PRP45_EMENI5.632e-2337.74Pre-mRNA-processing protein 45 OS=Emericella nidul... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900365 VSS Citrus sinensis cDNA clone VS28933 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900365 ID=DC900365|Name=DC900365|organism=Citrus sinensis|type=EST|length=609bp
GGGAGAGGGAAAGGGAGAGAAGGTTGGAGGCCAAGGATGCTGCTATGGGA
AAGAAGAGTAAGATTACTAGAGACAGAGATCGTGATATTAGTGAGAAATT
TGCTCTTGGCATGGCCTCGACTGGGGCGGCAAGAGGAGGTGAGGTTACTT
TTNATCAAAGGCTGTTCAACCAGGAGAAAGGAATGGATTCTGGTTTCGCC
ACTGATGACCAGTACAATGTGTATGACAAGGGCCTGTTTACTGCTCAGCC
CACACTTTCAACCCTATATAGGCCCAAGAAAGATGCAGATGATGACATGT
ATGGAGGAAACGCAGATGAACAGATGGAGAAGATTATGAAGACTGATCGG
TTCAAACCTGACAAGGGATTTGCTGGTAGTTCTGAGAGGTCTGGTCCTAG
AGACAGACCAGTCGAGTTTGAGAAGGAGGCTGAAGAAGCCGATCCATTTG
GTCTTGATGAGTTCTTGACAGAGGTGGAGAAGGGGGGGAAGAAAGCATTG
GACAAAGTTGGNACTGGAGGGACAATGAGAGCGAGTGCCGGATCTTCAAT
GCGAGATGATTATGGAGGTTCTGGTAGATCTCGCATAGGATTTGAAAGGG
GCCGTTAAG
back to top