DC900363

Overview
NameDC900363
Unique NameDC900363
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1374
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900363_ssr1068 microsatellite DC900363_ssr1068:1068..1083. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7102 contig Csv1_Contig7102:114..1481. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHID_SOLLC (Basic endochitinase (Fragment) OS=Solanum lycopersicum GN=CHI14 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 4.274e-49
Identity = 101/254 (39.76%), Postives = 137/254 (53.94%), Query Frame = 1
Query:  232 NETISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            ++ IS       FE     RN     A GF+ Y++FITAT  +    FGTTG    + KEI AFLA    +T+ G+  A  GP +WG CYN E      YC  S ++  PC PG +Y+GRG I I +NYNYGA G A+  +LLN+P+ +  +A ++F+ A+W WMT  ++ +PSAHD   G W P+  D+   R P FG   NI+ G   C  G    M+N +  Y  Y  +LGV      P   L CA Q+ F
Sbjct:    2 SQNISSLISKNLFERILVHRNDRACGAKGFYTYEAFITATKTFA--AFGTTGDTNTRNKEIAAFLAQTSHETTGGWATAPDGPYSWGYCYNREQGSPGDYCASSQQW--PCAPGKKYFGRGPIQISYNYNYGAAGSAIGVNLLNNPDLVANDAVVSFKTALWFWMT-AQQPKPSAHDVITGRWSPSVADSAPGRVPGFGVITNIINGGMECNSGSNALMDNRIGFYRRYCQILGV-----DPGNNLDCANQRPF 245          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 8.060e-48
Identity = 94/243 (38.68%), Postives = 134/243 (55.14%), Query Frame = 1
Query:  265 QFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            QF++    RN     A GF+ Y +FI A   +   GFGTTG    + KEI AF      +T+ G+  A  GP +WG C+  E +PS +YC  S ++  PC  G  YYGRG + + WNYNYG  G A+ +DLLN+P+ +  +  +AF+AAIW WMTP +  +PS H   VG W+P+  D  + R P +G   NI+ G   CG+G    + + +  Y  Y ++LGV      P   L C  Q++F
Sbjct:   79 QFDDMLKHRNDNACPARGFYTYDAFINAAKSFP--GFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPSSNYCSPSAEW--PCASGKSYYGRGPMQLSWNYNYGQCGRAIGSDLLNNPDLVSNDPVIAFKAAIWFWMTP-QSPKPSCHAVIVGQWQPSDADRAAGRVPGYGVITNIINGGLECGRGQDARVADRIGFYQRYCNILGV-----NPGGNLDCYNQRSF 311          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIB_ARATH (Basic endochitinase B OS=Arabidopsis thaliana GN=CHI-B PE=1 SV=3)

HSP 1 Score: 189.504 bits (480), Expect = 4.000e-47
Identity = 92/243 (37.86%), Postives = 132/243 (54.32%), Query Frame = 1
Query:  265 QFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            QF++    RN     A GF+ Y +FITA   +   GFGTTG    + KE+ AF      +T+ G+  A  GP +WG C+  E +P+  YC+ S   T+PC  G  YYGRG + + WNYNYG  G A+  DLLN+P+ +  +A +AF+AAIW WMT  +  +PS H    G W+P+  D  + R P +G   NI+ G   CG+G    + + +  Y  Y ++ GV      P   L C  Q++F
Sbjct:   94 QFDDMLKHRNDAACPARGFYTYNAFITAAKSFP--GFGTTGDTATRKKEVAAFFGQTSHETTGGWATAPDGPYSWGYCFKQEQNPASDYCEPSA--TWPCASGKRYYGRGPMQLSWNYNYGLCGRAIGVDLLNNPDLVANDAVIAFKAAIWFWMT-AQPPKPSCHAVIAGQWQPSDADRAAGRLPGYGVITNIINGGLECGRGQDGRVADRIGFYQRYCNIFGV-----NPGGNLDCYNQRSF 326          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.520e-46
Identity = 93/242 (38.43%), Postives = 133/242 (54.96%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN P   A GF+ Y +F+ A   +    FGTTG+   + +E+ AFL     +T+ G+  A  GP AWG C+  E +PS +YC  S +Y  PC PG  YYGRG + + WNYNYG  GEAL+ +LL +P+ +  +  L+F+ A+W WMTP +  +PS HD   G W+P+  DT + R P +G   N+L G   CG+G    + + +  +  Y  LLGV     G    L C  Q+ F
Sbjct:   11 FDQMLKHRNNPACPAKGFYTYDAFLAAAKSFP--SFGTTGSTDVRKRELAAFLGQTSHETTGGWPSAPDGPYAWGYCFLKERNPSSNYCAPSPRY--PCAPGKSYYGRGPLQLSWNYNYGPCGEALRVNLLGNPDLVATDRVLSFKTALWFWMTP-QAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRYCGLLGV-----GTGNNLDCYNQRPF 242          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI3_TOBAC (Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 7.544e-46
Identity = 94/252 (37.30%), Postives = 132/252 (52.38%), Query Frame = 1
Query:  241 ISDYFQVYQFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN 996
            IS+      F+     RN        F+ Y +FITA   ++  GFGTTG    + +E+ AF A    +T+ G+  A  G  AWG CY  E     SYC  S ++  PC PG +YYGRG I I +NYNYG  G A+  +LLN+P+ +  NA ++F++AIW WMT  +  +PS HD   G W P+  D  + R P +G   NI+ G   CG G    + + +  Y  Y  +LGV      P + + C  QK+FN
Sbjct:   85 ISNIISSSMFDQMLKHRNDNTCQGKSFYTYNAFITAARSFR--GFGTTGDTTRRKREVAAFFAQTSHETTGGWDTAPDGRYAWGYCYLREQGNPPSYCVQSSQW--PCAPGQKYYGRGPIQISYNYNYGPCGRAIGQNLLNNPDLVATNAVVSFKSAIWFWMT-AQSPKPSCHDVITGRWTPSAADRAANRLPGYGVITNIINGGLECGHGSDARVQDRIGFYRRYCSILGV-----SPGDNIDCGNQKSFN 326          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIX_PEA (Endochitinase OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 9.853e-46
Identity = 93/242 (38.43%), Postives = 132/242 (54.55%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN       GF+ Y +FI A   +   GFGTTG    K KE+ AFLA    +T+ G+  A  GP AWG C+  E +  + YC       +PC PG +YYGRG I +  NYNYG  G+A+K DL+N+P+ +  N T++F+ AIW WMTP + ++PS+HD   G W P+  D+ + R P +G   NI+ G   CG G  + +++ V  Y  Y  + GV      P   L C  Q++F
Sbjct:   89 FDQMLKYRNDGRCAGHGFYTYDAFIAAARSFN--GFGTTGDDNTKKKELAAFLAQTSHETTGGWPTAPDGPYAWGYCFVSEQNTQEVYCSPK---DWPCAPGKKYYGRGPIQLTHNYNYGLAGQAIKEDLINNPDLLSTNPTVSFKTAIWFWMTP-QANKPSSHDVITGRWTPSAADSSAGRVPGYGVITNIINGGIECGHGQDNRVDDRVGFYKRYCQIFGV-----DPGGNLDCNNQRSF 319          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.195e-45
Identity = 94/245 (38.37%), Postives = 134/245 (54.69%), Query Frame = 1
Query:  265 QFENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYG-VATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFN 996
            +F+     RN     A GF+ Y +FI A   +    F TTG    + +E+ AFLA    +T+ G G  A  GP  WG CYN E++P+  YC   +   YPC PG +Y+GRG + + WNYNYG  G A+  DLLN+P+ +  + T++F++A W WMTP +  +PS HD  +G W P+ +D  + R P FG   NI+ G   CGQG    + + +  Y  Y D LGVG         L C  Q+++N
Sbjct:   80 RFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFP--AFATTGDDATRKREVAAFLAQTSHETTGGAGWAAPDGPYTWGYCYNRELNPAD-YCQ--WDPNYPCAPGKQYFGRGPMQLTWNYNYGQCGRAIGVDLLNNPDLLATDPTISFKSAFWFWMTP-QSPKPSCHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGFYKRYCDTLGVGY-----GNNLDCYNQRSYN 313          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.195e-45
Identity = 93/243 (38.27%), Postives = 130/243 (53.50%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYG-VATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F      RN     A GF+ Y +FI A   +    F TTG +  + +EI AFLA    +T+ G G  A  GP AWG CYN E++P  SYC     Y  PC PG +Y+GRG + + WNYNYG  G A+  DLLN+P+ +  + T++F++A W WMTP +  +PS H+  +G W P+ +D  + R P +G   NI+ G   CG+G    + + +  Y  Y D+LGV          L C  Q  F
Sbjct:   83 FNQMLLHRNDGACPARGFYTYDAFIAAARSFP--AFATTGDQATRKREIAAFLAQTSHETTGGAGWAAPDGPYAWGYCYNRELNPPSSYCASDPNY--PCAPGKQYFGRGPMQLSWNYNYGQCGRAIGVDLLNNPDLLSSDPTISFKSAFWFWMTP-QSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSY-----GNNLDCYNQSPF 315          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHI2_ORYSJ (Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht2 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 2.867e-45
Identity = 91/251 (36.25%), Postives = 135/251 (53.78%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAFNPNTAPSAA 1020
            FE     RN     A GF+ Y++F+ A   +    FG TG    + +E+ AFL     +T+ G+  A  GP +WG C+  E +P   YC  S ++  PC PG +YYGRG I + +N+NYG  G A+  DLL++P+ +  +AT++F+ A+W WMTP + ++PS+HD   G W P+  D  + R P +G   NI+ G   CG G  D + N +  Y  Y    G+G    G N  L C  Q+ FN  ++   A
Sbjct:   98 FERLLLHRNDGACPARGFYTYEAFLAAAAAFP--AFGGTGNTETRKREVAAFLGQTSHETTGGWPTAPDGPFSWGYCFKQEQNPPSDYCQPSPEW--PCAPGRKYYGRGPIQLSFNFNYGPAGRAIGVDLLSNPDLVATDATVSFKTALWFWMTP-QGNKPSSHDVITGRWAPSPADAAAGRAPGYGVITNIVNGGLECGHGPDDRVANRIGFYQRYCGAFGIG---TGGN--LDCYNQRPFNSGSSVGLA 338          
BLAST of DC900363 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 3.744e-45
Identity = 92/242 (38.02%), Postives = 130/242 (53.72%), Query Frame = 1
Query:  268 FENFFSKRNTPVAHAVGFWDYQSFITATVKYQPLGFGTTGTKLDKMKEICAFLAHVGCKTSCGYGVATGGPLAWGLCYNHEMSPSQSYCDDSYKYTYPCTPGAEYYGRGAIPIYWNYNYGATGEALKADLLNHPEYIEQNATLAFEAAIWKWMTPVKKSQPSAHDAFVGNWKPTKNDTLSKRGPNFGTTMNILYGESVCGQGDIDAMNNIVSHYLYYLDLLGVGREQAGPNEELSCAEQKAF 993
            F+     RN     A GF+ Y +FI A   Y    FG TG    + +EI AFL     +T+ G+  A  GP AWG C+  E +PS +YC  + ++  PC PG +YYGRG I I WNYNYG  G A+  DLLN P+ +  ++ ++F++A+W WMT  +  +PS+HD     W P+  D  ++R P +GT  NI+ G   CG+G    + + +  +  Y DLLGVG         L C  Q  F
Sbjct:   85 FDQMLKHRNDGACPAKGFYTYDAFIAAAKAYP--SFGNTGDTATRKREIAAFLGQTSHETTGGWATAPDGPYAWGYCFVRERNPS-TYCSATPQF--PCAPGQQYYGRGPIQISWNYNYGQCGRAIGVDLLNKPDLVATDSVISFKSALWFWMT-AQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGVGY-----GNNLDCYSQTPF 315          
The following BLAST results are available for this feature:
BLAST of DC900363 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 55
Match NameE-valueIdentityDescription
CHID_SOLLC4.274e-4939.76Basic endochitinase (Fragment) OS=Solanum lycopers... [more]
CHI2_BRANA8.060e-4838.68Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHIB_ARATH4.000e-4737.86Basic endochitinase B OS=Arabidopsis thaliana GN=C... [more]
CHIT_CARPA1.520e-4638.43Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI3_TOBAC7.544e-4637.30Endochitinase 3 OS=Nicotiana tabacum GN=CHN14 PE=3... [more]
CHIX_PEA9.853e-4638.43Endochitinase OS=Pisum sativum PE=2 SV=1[more]
CHI1_THECC2.195e-4538.37Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHI1_GOSHI2.195e-4538.27Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI2_ORYSJ2.867e-4536.25Chitinase 2 OS=Oryza sativa subsp. japonica GN=Cht... [more]
CHIT_PHAVU3.744e-4538.02Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900363 VSS Citrus sinensis cDNA clone VS28931 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900363 ID=DC900363|Name=DC900363|organism=Citrus sinensis|type=EST|length=1374bp
CTCATCTTCCCCCAAGTGAATCTCGAAACAACAGGTAGATCTGGTGAGAA
CGAGAAAATGAAGATGAAGAATGGCAGTGTGGCAATGACACTGACAGTGG
CACTAGTACTGGCACTGGCAGTGAGTTTGGCAAATGGAGATGAATCAGAG
AAGGTGATAGTGAAGAAGTTGAAGGGGAAAAAAGTTTGCATAAAAGGGTG
GGAGTGCCCAACATGGTCGAAATTCTGCTGTAACGAGACGATATCAGACT
ATTTCCAGGTTTACCAGTTTGAGAATTTCTTCTCGAAAAGGAACACGCCG
GTGGCACATGCCGTGGGATTCTGGGATTATCAGTCTTTCATTACTGCCAC
CGTCAAATATCAGCCCCTCGGCTTCGGTACCACCGGTACTAAGCTTGATA
AGATGAAGGAGATTTGCGCTTTTCTTGCCCACGTGGGCTGCAAGACCTCT
TGTGGATATGGAGTGGCCACTGGAGGACCATTGGCCTGGGGACTTTGCTA
CAACCATGAAATGAGCCCCAGTCAGTCATATTGTGATGATTCCTACAAAT
ACACATATCCCTGCACCCCTGGAGCTGAGTACTATGGCCGAGGTGCTATA
CCTATATACTGGAACTATAACTATGGAGCCACTGGGGAAGCATTGAAGGC
AGATCTGTTGAATCATCCCGAATACATTGAGCAGAATGCTACCCTTGCCT
TTGAGGCTGCAATTTGGAAGTGGATGACCCCAGTCAAGAAATCCCAGCCT
TCAGCCCATGATGCCTTTGTTGGCAACTGGAAGCCCACCAAGAATGATAC
TTTGTCCAAACGGGGACCTAACTTTGGTACCACAATGAATATCCTCTATG
GTGAGAGCGTATGCGGTCAGGGTGATATTGATGCTATGAACAACATTGTC
TCTCATTACTTGTATTACCTTGATCTGTTGGGTGTTGGCCGAGAGCAGGC
AGGACCTAATGAAGAACTCTCTTGTGCTGAGCAGAAAGCCTTCAACCCAA
ACACCGCACCTTCAGCTGCATCTTCTTGAGGACGTTTATTGTAGCCAAGC
TATTATTGTGGGAGTGACTCTCTCTCTCTCTCTAGGTGGGTACCATTACA
ATAAGACTGGGGTTAATTAAACTATTTGTTGTAAGTTTTTTTTTTTTTTT
CCATCTTTTCATATATTGCGCAAGGTCAATTAGTGTGTGGATTGGTCTGC
CCCTCTTCATTGCCGTTGTAGATTTGAGATTCATTTGGTTTGTAAAATCT
TCGTTATATCTGGTTACATATGTAATGATGAACCGCATGAACCACTCGTG
TGTTTCAATAGCAGAATTGTAAAGTATATGCTTATATTTTATTTATTCCG
GGATATCGACTCCTAGTTTCGTTT
back to top