DC900360

Overview
NameDC900360
Unique NameDC900360
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length275
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900360 vs. ExPASy Swiss-Prot
Match: PME3_SOLLC (Pectinesterase 3 OS=Solanum lycopersicum GN=PME3 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.967e-12
Identity = 31/54 (57.41%), Postives = 40/54 (74.07%), Query Frame = 1
Query:    1 FNNYGPGSGTDNRVTWPGYHVM-DENDAYAFTVSQLIDGQEWLDSTSIPYQDGI 159
            F N GPG+GT  RV WPGYHV+ D N+A  FTV++LI G  WL+STS+ Y +G+
Sbjct:  489 FMNNGPGAGTSKRVKWPGYHVITDPNEAMPFTVAELIQGGSWLNSTSVAYVEGL 542          
BLAST of DC900360 vs. ExPASy Swiss-Prot
Match: PME12_ARATH (Probable pectinesterase/pectinesterase inhibitor 12 OS=Arabidopsis thaliana GN=PME12 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.181e-12
Identity = 29/53 (54.72%), Postives = 36/53 (67.92%), Query Frame = 1
Query:    1 FNNYGPGSGTDNRVTWPGYHVMDENDAYAFTVSQLIDGQEWLDSTSIPYQDGI 159
            +NN GPGS T  RV WPG+H+M   DA+ FT ++ I G  WL STS PY +GI
Sbjct:  495 YNNNGPGSETVKRVNWPGFHIMGYEDAFNFTATEFITGDGWLGSTSFPYDNGI 547          
BLAST of DC900360 vs. ExPASy Swiss-Prot
Match: PME44_ARATH (Probable pectinesterase/pectinesterase inhibitor 44 OS=Arabidopsis thaliana GN=PME44 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.507e-11
Identity = 31/54 (57.41%), Postives = 37/54 (68.52%), Query Frame = 1
Query:    1 FNNYGPGSGTDNRVTWPGYHVMDEND-AYAFTVSQLIDGQEWLDSTSIPYQDGI 159
            F NYGPGSG  +RV WPGYHV + +D A  FTVSQ I G  WL ST + + DG+
Sbjct:  470 FMNYGPGSGLSSRVKWPGYHVFNNSDQANNFTVSQFIKGNLWLPSTGVTFSDGL 523          
BLAST of DC900360 vs. ExPASy Swiss-Prot
Match: PME20_ARATH (Probable pectinesterase/pectinesterase inhibitor 20 OS=Arabidopsis thaliana GN=PME20 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.507e-11
Identity = 27/53 (50.94%), Postives = 37/53 (69.81%), Query Frame = 1
Query:    1 FNNYGPGSGTDNRVTWPGYHVMDENDAYAFTVSQLIDGQEWLDSTSIPYQDGI 159
            +NN GPGS T NRVTWPGYHV++  DA  FTV+  + G+ W+  T +P+  G+
Sbjct:  506 YNNTGPGSDTTNRVTWPGYHVINATDASNFTVTNFLVGEGWIGQTGVPFVGGL 558          
BLAST of DC900360 vs. ExPASy Swiss-Prot
Match: PME7_ARATH (Probable pectinesterase/pectinesterase inhibitor 7 OS=Arabidopsis thaliana GN=PME7 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.571e-11
Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 1
Query:    1 FNNYGPGSGTDNRVTWPGYHVMDENDAYAFTVSQLIDGQEWLDSTSIPYQDGI 159
            +NN GPGS T NRVTWPGYHV++  DA  FTV+ L    +W+  T +PY  G+
Sbjct:  525 YNNTGPGSNTTNRVTWPGYHVINSTDAANFTVTGLFIEADWIWKTGVPYTSGL 577          
BLAST of DC900360 vs. ExPASy Swiss-Prot
Match: PME21_SOLLC (Pectinesterase 2.1 OS=Solanum lycopersicum GN=PME2.1 PE=2 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 5.728e-11
Identity = 30/54 (55.56%), Postives = 38/54 (70.37%), Query Frame = 1
Query:    1 FNNYGPGSGTDNRVTWPGYHVM-DENDAYAFTVSQLIDGQEWLDSTSIPYQDGI 159
            F N GPG+GT  RV WPGYHV+ D  +A +FTV++LI G  WL ST + Y DG+
Sbjct:  495 FMNNGPGAGTSKRVKWPGYHVITDPAEAMSFTVAKLIQGGSWLRSTDVAYVDGL 548          
The following BLAST results are available for this feature:
BLAST of DC900360 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PME3_SOLLC3.967e-1257.41Pectinesterase 3 OS=Solanum lycopersicum GN=PME3 P... [more]
PME12_ARATH5.181e-1254.72Probable pectinesterase/pectinesterase inhibitor 1... [more]
PME44_ARATH1.507e-1157.41Probable pectinesterase/pectinesterase inhibitor 4... [more]
PME20_ARATH1.507e-1150.94Probable pectinesterase/pectinesterase inhibitor 2... [more]
PME7_ARATH2.571e-1152.83Probable pectinesterase/pectinesterase inhibitor 7... [more]
PME21_SOLLC5.728e-1155.56Pectinesterase 2.1 OS=Solanum lycopersicum GN=PME2... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900360 VSS Citrus sinensis cDNA clone VS28923 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900360 ID=DC900360|Name=DC900360|organism=Citrus sinensis|type=EST|length=275bp
TTCAATAATTACGGTCCAGGTTCCGGGACCGATAATCGGGTCACTTGGCC
CGGGTATCATGTCATGGATGAGAATGATGCATATGCTTTTACTGTATCAC
AGTTAATTGATGGTCAGGAGTGGCTGGATTCAACTTCAATTCCTTACCAA
GATGGGATTTAATCACCATCTTTTGTGAAAATTAATTTTTATTTTTATTA
AGTTCGAATGTAACTAGAACTCTTGTTTGTATTAGTTTGGTTTCTAAAGT
AGATATTTATGAAATTAGGTTGACG
back to top