DC900359

Overview
NameDC900359
Unique NameDC900359
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1140
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900359 vs. ExPASy Swiss-Prot
Match: GI1L3_ARATH (Probable gibberellin receptor GID1L3 OS=Arabidopsis thaliana GN=GID1L3 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.041e-26
Identity = 89/280 (31.79%), Postives = 131/280 (46.79%), Query Frame = 3
Query:   36 DGTMTRNHSLYPNTAATPDPNDDTIALSKDVPVNQSNNTWVRIFLPRQALDSSTDTKF---------PLVVYTHGGGLLLLSAATKIYHDLCSEIVARVPAIIVSVDYRLAPEHRLPAAYDDAVEVLQWVKTTQEHWLRQYADFS-SCFIMGDSGGGNIAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILPPPQTDFTWQLALPIGADRDHEYSNPIVGGGSKFLDQFRLLGWKVMVTGGSEDTLFDRQVELAKLMEQKGVNV 845
            DGT  R+ + + +     + N      S DV +++  N   R++ P  A  S + T           P++V+ HGG     SA + IY  LC  +V    A++VSV+YR APE+R P AYDD   VL+WV ++   WLR   D     F+ GDS GGNI ++                          FGG +RTESE RL  +  +     D+ W+  LP G DR+H   +P  G  SK L+        V+V G   D + D Q++ A+ +++ G  V
Sbjct:   38 DGTFNRHLAEFLDRKVPANANPVNGVFSFDVIIDRQTNLLSRVYRPADAGTSPSITDLQNPVDGEIVPVIVFFHGGSFAHSSANSAIYDTLCRRLVGLCGAVVVSVNYRRAPENRYPCAYDDGWAVLKWVNSSS--WLRSKKDSKVRIFLAGDSSGGNIVHN-----VAVRAVESRIDVLGNILLNPMFGGTERTESEKRLDGKYFVTVRDRDWYWRAFLPEGEDREHPACSPF-GPRSKSLEGLSFPKSLVVVAG--LDLIQDWQLKYAEGLKKAGQEV 307          
BLAST of DC900359 vs. ExPASy Swiss-Prot
Match: GID1_ORYSJ (Gibberellin receptor GID1 OS=Oryza sativa subsp. japonica GN=GID1 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.564e-25
Identity = 90/290 (31.03%), Postives = 130/290 (44.83%), Query Frame = 3
Query:   33 SDGTMTRNHSLYPNTAATPDPNDDTIALSKDVPVNQSNNTWVRIF--------------LPRQALDSSTDTK----FPLVVYTHGGGLLLLSAATKIYHDLCSEIVARVPAIIVSVDYRLAPEHRLPAAYDDAVEVLQWVKTTQEHWLRQYADFSS-CFIMGDSGGGNIAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILPPPQTDFTWQLALPIGADRDHEYSNPIVGGGSKFLDQFRLLGWKVMVTGGSEDTLFDRQVELAKLMEQKGVNV 845
            +DGT  R+   Y +     +        S D  ++QS    VRI+              + R  L+  TD      FP++++ HGG  +  SA++ IY  LC   V     ++VSV+YR APEHR P AYDD    L+WV +  + ++R   D  +  F+ GDS GGNIA+H                          FGG +RTESE RL  +  +     D+ W+  LP  ADRDH   NP  G   + L         ++V+G   D   DRQ+  A  + + G +V
Sbjct:   37 ADGTFERDLGEYLDRRVPANARPLEGVSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILEFLTDAPAAEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEHRYPCAYDDGWTALKWVMS--QPFMRSGGDAQARVFLSGDSSGGNIAHH-----VAVRAADEGVKVCGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPF-GPNGRRLGGLPFAKSLIIVSG--LDLTCDRQLAYADALREDGHHV 316          
BLAST of DC900359 vs. ExPASy Swiss-Prot
Match: GI1L1_ARATH (Probable gibberellin receptor GID1L1 OS=Arabidopsis thaliana GN=GID1L1 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.191e-22
Identity = 86/282 (30.50%), Postives = 125/282 (44.33%), Query Frame = 3
Query:   36 DGTMTRNHSLYPNTAATPDPNDDTIALSKDVPVNQSNNTWVRIFLPRQA----------LDSSTDTKF-PLVVYTHGGGLLLLSAATKIYHDLCSEIVARVPAIIVSVDYRLAPEHRLPAAYDDAVEVLQWVKTTQEHWLRQYADFS-SCFIMGDSGGGNIAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILPPPQTDFTWQLALPIGADRDHEYSNPIVGGGSKFLDQFRLLGWKVMVTGGSEDTLFDRQVELAKLMEQKGVNV 845
            DGT  R+ + Y +   T + N      S DV +++  N   R++ P  A          L+   D    P++++ HGG     SA + IY  LC  +V     ++VSV+YR APE+  P AYDD    L WV +    WL+   D     F+ GDS GGNIA++                          FGG +RTESE  L  +  +     D+ W+  LP G DR+H   NP    G K L+        V+V G   D + D Q+  A+ +++ G  V
Sbjct:   38 DGTFNRHLAEYLDRKVTANANPVDGVFSFDVLIDRRINLLSRVYRPAYADQEQPPSILDLEKPVDGDIVPVILFFHGGSFAHSSANSAIYDTLCRRLVGLCKCVVVSVNYRRAPENPYPCAYDDGWIALNWVNS--RSWLKSKKDSKVHIFLAGDSSGGNIAHN-----VALRAGESGIDVLGNILLNPMFGGNERTESEKSLDGKYFVTVRDRDWYWKAFLPEGEDREHPACNPFSPRG-KSLEGVSFPKSLVVVAG--LDLIRDWQLAYAEGLKKAGQEV 309          
BLAST of DC900359 vs. ExPASy Swiss-Prot
Match: GI1L2_ARATH (Probable gibberellin receptor GID1L2 OS=Arabidopsis thaliana GN=GID1L2 PE=1 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 1.720e-21
Identity = 67/204 (32.84%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  132 VNQSNNTWVRIFLPRQALDS------------STDTKFPLVVYTHGGGLLLLSAATKIYHDLCSEIVARVPAIIVSVDYRLAPEHRLPAAYDDAVEVLQWVKTTQEHWLRQYADFS-SCFIMGDSGGGNIAYHXXXXXXXXXXXXXXXXXXXXXXXXXFFGGVKRTESELRLANQPILPPPQTDFTWQLALPIGADRDHEYSNP 704
            V+ + N   RI+ P   L              ST    P++++ HGG     SA + IY   C  +V     ++VSVDYR +PEHR P AYDD    L WVK+    WL+   D +   ++ GDS GGNIA++                          FGG +RT+SE  L  +  +     D+ W+  LP G DRDH   NP
Sbjct:   69 VDSTTNLLTRIYQPASLLHQTRHGTLELTKPLSTTEIVPVLIFFHGGSFTHSSANSAIYDTFCRRLVTICGVVVVSVDYRRSPEHRYPCAYDDGWNALNWVKS--RVWLQSGKDSNVYVYLAGDSSGGNIAHN-----VAVRATNEGVKVLGNILLHPMFGGQERTQSEKTLDGKYFVTIQDRDWYWRAYLPEGEDRDHPACNP 265          
The following BLAST results are available for this feature:
BLAST of DC900359 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
GI1L3_ARATH1.041e-2631.79Probable gibberellin receptor GID1L3 OS=Arabidopsi... [more]
GID1_ORYSJ2.564e-2531.03Gibberellin receptor GID1 OS=Oryza sativa subsp. j... [more]
GI1L1_ARATH1.191e-2230.50Probable gibberellin receptor GID1L1 OS=Arabidopsi... [more]
GI1L2_ARATH1.720e-2132.84Probable gibberellin receptor GID1L2 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900359 VSS Citrus sinensis cDNA clone VS28922 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900359 ID=DC900359|Name=DC900359|organism=Citrus sinensis|type=EST|length=1140bp
ATTTCCCCCAACACCCTATGTTCACCTTCAACTCCGACGGCACGATGACT
CGCAACCACAGCCTCTACCCAAACACCGCAGCCACACCCGATCCAAATGA
CGACACCATAGCTCTCTCCAAAGATGTCCCCGTCAACCAATCAAACAACA
CTTGGGTCCGCATATTCCTGCCCCGTCAAGCACTTGATTCTTCCACCGAC
ACCAAGTTTCCCCTCGTAGTTTACACCCACGGTGGAGGCCTCCTTCTCTT
AAGCGCAGCCACAAAAATCTACCATGATTTATGCTCAGAAATTGTAGCCC
GAGTCCCTGCCATTATTGTGTCAGTAGATTACAGGCTTGCCCCCGAGCAC
CGCCTCCCAGCGGCCTATGATGATGCCGTGGAAGTCTTGCAATGGGTCAA
AACCACTCAAGAACACTGGTTGCGACAATACGCTGACTTCTCGTCTTGTT
TCATAATGGGTGATAGCGGAGGTGGCAACATCGCTTACCACGCAGCACTG
CAAGCAGCGGCACAAGTTGATGATTTGTTACCTTTGAAGATCAAAGGGCT
GATATTGCTCAAGCCTTTCTTCGGTGGGGTCAAAAGGACTGAGTCAGAGT
TGAGGTTGGCCAATCAACCGATTTTACCACCACCTCAAACTGATTTCACG
TGGCAGTTAGCATTACCCATCGGAGCTGACCGCGATCATGAGTATTCCAA
TCCAATTGTGGGAGGTGGGTCAAAGTTTTTAGACCAATTCAGGTTGTTAG
GGTGGAAGGTGATGGTGACTGGGGGCAGTGAGGATACGTTGTTTGACCGT
CAAGTTGAACTGGCGAAGTTGATGGAGCAGAAGGGTGTGAATGTGGTGAG
TTATTTTGATGATAGCCCCCACGATATGATTGGCGATCCTGTCAAGCTTG
AGGCTCTGTATGTTAACATAAAAAAATTCATTTTGTCTTGAGAATTAATG
TGGCTGCATATTATAAATGTTACGTGAGTGATCGATACAGCCAGTTTAAG
TGGTGTTTTATTTGTTATAGCTGCTTCTGTGCTGTTGGCCCCGTGTTAAC
ATAAAAAGATCAGATCTTGTCTGGTGTGATAGATTGTTAATTGCTCCGGC
TTTGTCATGATCATAAATATATTAACAGCAATTAAGCATC
back to top