DC900358

Overview
NameDC900358
Unique NameDC900358
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length618
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5661 contig Csv1_Contig5661:1..618. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900358 vs. ExPASy Swiss-Prot
Match: Y3627_ARATH (VHS domain-containing protein At3g16270 OS=Arabidopsis thaliana GN=At3g16270 PE=1 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.132e-17
Identity = 46/72 (63.89%), Postives = 51/72 (70.83%), Query Frame = 1
Query:    4 QHIGNLNVHNSGAANLVGGNGG--SPLPDIFQPNFPTQASMPALNNSKKEDTRAFDFISDHLASARDSKRVA 213
            Q  GNLN   SG    +G +GG  S LPDIFQPNF  QA    +N SKKEDTRAFDFISDHL SARD+KRV+
Sbjct:  619 QQFGNLNAQGSGNVLSMGTSGGNQSALPDIFQPNFGNQAPTSTMNGSKKEDTRAFDFISDHLTSARDTKRVS 690          
The following BLAST results are available for this feature:
BLAST of DC900358 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y3627_ARATH2.132e-1763.89VHS domain-containing protein At3g16270 OS=Arabido... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900358 VSS Citrus sinensis cDNA clone VS28921 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900358 ID=DC900358|Name=DC900358|organism=Citrus sinensis|type=EST|length=618bp
CTTCAACATATTGGTAACCTGAATGTTCATAATTCTGGTGCCGCCAATTT
GGTTGGAGGAAATGGAGGCTCACCACTTCCAGATATATTCCAACCAAACT
TTCCAACTCAAGCTTCCATGCCTGCCCTGAACAATTCAAAGAAAGAGGAC
ACGAGAGCATTCGATTTTATCTCAGACCATCTTGCATCAGCTCGTGATTC
GAAGAGGGTTGCTTAAATTTTGGTGTTTATTCTTGCTGAGGCTTTATTTA
TACGAGGCAAGTAGGTCGAGAGCAAGATGTTAGTCTTAGTACTGAGATGG
TTATCTCTTTTCATCACATAAATGGAAGGGAGGTGTGGTTGAAGAATAGA
GTGAAACAGCTCATTGGTTCATAGCATTGTTGGTATATGAGATGGAAGAC
AAGAAATGGCCATGCAGTTAGCTTTTTATATTCTTTTTTTTTTTTTTCTA
ATTTGTACACTTTGCCCGTTGTCCTGTTGGTTCTTCCTTTACGATGAATT
TGTCAAGTCTTTTCTATTGTTAATTCCCGTGACTGCATAAAATGCACACC
ATGAGAAATGCTTCTTTGTTGGACAGTAGTCAATAATAGTCAATATATTG
TCGTTTTAGTTAGCATTC
back to top