DC900355

Overview
NameDC900355
Unique NameDC900355
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length455
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9788 contig Csv1_Contig9788:70..524. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_ARATH (40S ribosomal protein S18 OS=Arabidopsis thaliana GN=RPS18A PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 5.121e-65
Identity = 121/125 (96.80%), Postives = 124/125 (99.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLVANE+FQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAE+DNLM +VANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH
Sbjct:    1 MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAEIDNLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 125          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_BRABE (40S ribosomal protein S18 OS=Branchiostoma belcheri GN=RPS18 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.688e-51
Identity = 94/125 (75.20%), Postives = 113/125 (90.40%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRV+NTN+DG++KIMFALTSIKG+GRR +NIVCKKAD+D++KRAGELS  E++ L+ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N+LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVMNTNIDGRRKIMFALTSIKGVGRRYSNIVCKKADIDLSKRAGELSDEEVERLITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVMANSLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.688e-51
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_AEQIR (40S ribosomal protein S18 OS=Aequipecten irradians GN=RPS18 PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 8.283e-51
Identity = 92/125 (73.60%), Postives = 113/125 (90.40%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            M+L+  E FQHILRV+NTN+DGK+KIMFA+T+IKG+GRR AN+VCKKADVD+ KRAGELS  E++ ++ +++NPRQ+KIP+WFLNRQKD KDGKYSQV+SNALD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MALIIPEKFQHILRVMNTNIDGKRKIMFAMTAIKGMGRRYANVVCKKADVDITKRAGELSEDEIERVITIMSNPRQYKIPNWFLNRQKDVKDGKYSQVMSNALDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 8.283e-51
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_DANRE (40S ribosomal protein S18 OS=Danio rerio GN=rps18 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 2.164e-48
Identity = 88/125 (70.40%), Postives = 110/125 (88.00%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+NKRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLNKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDIKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 2.164e-48
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_ICTPU (40S ribosomal protein S18 OS=Ictalurus punctatus GN=rps18 PE=2 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 8.140e-48
Identity = 87/125 (69.60%), Postives = 110/125 (88.00%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D++KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLSKRAGELTEDEVERVVTIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 8.140e-48
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_RAT (40S ribosomal protein S18 OS=Rattus norvegicus GN=Rps18 PE=1 SV=3)

HSP 1 Score: 188.348 bits (477), Expect = 1.061e-47
Identity = 87/125 (69.60%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+ KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.061e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_PIG (40S ribosomal protein S18 OS=Sus scrofa GN=RPS18 PE=2 SV=3)

HSP 1 Score: 188.348 bits (477), Expect = 1.061e-47
Identity = 87/125 (69.60%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+ KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.061e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_MOUSE (40S ribosomal protein S18 OS=Mus musculus GN=Rps18 PE=2 SV=3)

HSP 1 Score: 188.348 bits (477), Expect = 1.061e-47
Identity = 87/125 (69.60%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+ KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.061e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_HUMAN (40S ribosomal protein S18 OS=Homo sapiens GN=RPS18 PE=1 SV=3)

HSP 1 Score: 188.348 bits (477), Expect = 1.061e-47
Identity = 87/125 (69.60%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+ KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.061e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
BLAST of DC900355 vs. ExPASy Swiss-Prot
Match: RS18_CAPHI (40S ribosomal protein S18 OS=Capra hircus GN=RPS18 PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.061e-47
Identity = 87/125 (69.60%), Postives = 109/125 (87.20%), Query Frame = 2
Query:   38 MSLVANEDFQHILRVLNTNVDGKQKIMFALTSIKGIGRRLANIVCKKADVDMNKRAGELSAAELDNLMVVVANPRQFKIPDWFLNRQKDYKDGKYSQVVSNALDMKLRDDLERLKKIRNHRGLRH 412
            MSLV  E FQHILRVLNTN+DG++KI FA+T+IKG+GRR A++V +KAD+D+ KRAGEL+  E++ ++ ++ NPRQ+KIPDWFLNRQKD KDGKYSQV++N LD KLR+DLERLKKIR HRGLRH
Sbjct:    1 MSLVIPEKFQHILRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRH 125          

HSP 2 Score: 23.0978 bits (48), Expect = 1.061e-47
Identity = 10/12 (83.33%), Postives = 11/12 (91.67%), Query Frame = 1
Query:  415 WGLRVRG-HTQT 447
            WGLRVRG HT+T
Sbjct:  127 WGLRVRGQHTKT 138          
The following BLAST results are available for this feature:
BLAST of DC900355 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 60
Match NameE-valueIdentityDescription
RS18_ARATH5.121e-6596.8040S ribosomal protein S18 OS=Arabidopsis thaliana ... [more]
RS18_BRABE1.688e-5175.2040S ribosomal protein S18 OS=Branchiostoma belcher... [more]
RS18_AEQIR8.283e-5173.6040S ribosomal protein S18 OS=Aequipecten irradians... [more]
RS18_DANRE2.164e-4870.4040S ribosomal protein S18 OS=Danio rerio GN=rps18 ... [more]
RS18_ICTPU8.140e-4869.6040S ribosomal protein S18 OS=Ictalurus punctatus G... [more]
RS18_RAT1.061e-4769.6040S ribosomal protein S18 OS=Rattus norvegicus GN=... [more]
RS18_PIG1.061e-4769.6040S ribosomal protein S18 OS=Sus scrofa GN=RPS18 P... [more]
RS18_MOUSE1.061e-4769.6040S ribosomal protein S18 OS=Mus musculus GN=Rps18... [more]
RS18_HUMAN1.061e-4769.6040S ribosomal protein S18 OS=Homo sapiens GN=RPS18... [more]
RS18_CAPHI1.061e-4769.6040S ribosomal protein S18 OS=Capra hircus GN=RPS18... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900355 VSS Citrus sinensis cDNA clone VS28917 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900355 ID=DC900355|Name=DC900355|organism=Citrus sinensis|type=EST|length=455bp
CCTCTCTTCTCTTCATCATCAATCCTCACAATCGAAAATGTCTCTGGTGG
CGAACGAAGATTTTCAGCACATTTTGCGTGTGCTGAACACTAACGTCGAC
GGGAAGCAGAAGATTATGTTTGCTCTTACTTCAATTAAGGGTATTGGAAG
GCGACTGGCTAACATCGTTTGCAAGAAAGCTGATGTTGACATGAACAAGA
GGGCCGGTGAACTATCTGCTGCTGAACTTGACAATCTCATGGTCGTTGTT
GCAAATCCCCGACAGTTTAAAATCCCTGATTGGTTCTTGAACAGACAGAA
GGATTACAAAGATGGAAAGTATTCTCAGGTTGTATCCAATGCACTGGACA
TGAAGTTGAGAGATGATTTGGAGCGTCTGAAGAAGATCAGGAACCACCGT
GGTCTCAGGCACTCTGGGGTCTTCGTGTCCGTGGACACACACAGACACGC
GCGGA
back to top