DC900349

Overview
NameDC900349
Unique NameDC900349
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1064
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: R27A2_ARATH (60S ribosomal protein L27a-2 OS=Arabidopsis thaliana GN=RPL27AB PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 9.469e-35
Identity = 71/83 (85.54%), Postives = 79/83 (95.18%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            LRNKF CPIVN+DKLWS+VP+DVKAK+SKDNVP+IDVTQ G+FKVLGKG LPEN+P VVKAKL+SKTAEKKIKEAGGAVVLTA
Sbjct:   64 LRNKFFCPIVNLDKLWSLVPEDVKAKSSKDNVPLIDVTQHGFFKVLGKGHLPENKPFVVKAKLISKTAEKKIKEAGGAVVLTA 146          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: R27A3_ARATH (60S ribosomal protein L27a-3 OS=Arabidopsis thaliana GN=RPL27AC PE=2 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 2.109e-34
Identity = 70/83 (84.34%), Postives = 79/83 (95.18%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            LRNKF CPIVN+DKLWS+VP+DVKAK++KDNVP+IDVTQ G+FKVLGKG LPEN+P VVKAKL+SKTAEKKIKEAGGAVVLTA
Sbjct:   64 LRNKFFCPIVNLDKLWSLVPEDVKAKSTKDNVPLIDVTQHGFFKVLGKGHLPENKPFVVKAKLISKTAEKKIKEAGGAVVLTA 146          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_TETTH (60S ribosomal protein L27a OS=Tetrahymena thermophila GN=RPL27A PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 5.958e-21
Identity = 53/84 (63.10%), Postives = 64/84 (76.19%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDN--VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            +N  HCP+VNIDKLWS+V    + K ++D   VP+IDVT+ G+FKVLGKG LP NQPVVVKAK  SKTAE++I   GGA VLTA
Sbjct:   67 KNPLHCPVVNIDKLWSLVSDATRQKYAEDKKKVPVIDVTKAGFFKVLGKGRLP-NQPVVVKAKYFSKTAERRIVAVGGACVLTA 149          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_OSCBR (60S ribosomal protein L27a OS=Oscheius brevesophaga GN=rpl-27a PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 8.604e-20
Identity = 45/82 (54.88%), Postives = 61/82 (74.39%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDNVPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            +N  +CP VN+D+LW++VP++ K K S +  P+ID  + GYFKVLGKG+LP+ QP++VKAK  S  AE KIK AGGA +L A
Sbjct:   65 KNHHYCPTVNVDRLWALVPEEQKTKVSAEKAPVIDCVKAGYFKVLGKGLLPK-QPLIVKAKFFSHEAENKIKAAGGACILVA 145          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_DICDI (60S ribosomal protein L27a OS=Dictyostelium discoideum GN=rpl27a PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.124e-19
Identity = 45/86 (52.33%), Postives = 64/86 (74.42%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            LRN++HCP V+++K+W++VP+ V+   +  N    P++DVTQ G+FKVLG G+LP  QP++VKA+  SK AEKKIK  GGA +L A
Sbjct:   64 LRNQYHCPTVSLEKIWTLVPESVRKSLAAKNDGTAPVVDVTQKGFFKVLGHGILP-TQPIIVKARYFSKVAEKKIKAVGGACILVA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_EUPCR (60S ribosomal protein L27a OS=Euplotes crassus GN=RPL27A PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 9.513e-19
Identity = 47/85 (55.29%), Postives = 65/85 (76.47%), Query Frame = 2
Query:    2 LRNKFHCPIVNIDKLWSMVPQDVKAKASKDN--VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            +RN+++CP +N+ KLWS+V ++ + KA  D   V +IDV + GY+KVLGKG+LPE  P+VVKAKL + TAEK+IK+ GGA VL A
Sbjct:   64 MRNQYYCPSINLSKLWSLVTEEERQKAQTDKSKVILIDVVKHGYYKVLGKGLLPE-VPLVVKAKLFTPTAEKRIKQVGGACVLRA 147          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_PONAB (60S ribosomal protein L27a OS=Pongo abelii GN=RPL27A PE=2 SV=3)

HSP 1 Score: 91.6633 bits (226), Expect = 8.053e-18
Identity = 46/85 (54.12%), Postives = 61/85 (71.76%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            RN+  CP VN+DKLW++V +  +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL A
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEEKIKSVGGACVLVA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_HUMAN (60S ribosomal protein L27a OS=Homo sapiens GN=RPL27A PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 8.053e-18
Identity = 46/85 (54.12%), Postives = 61/85 (71.76%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            RN+  CP VN+DKLW++V +  +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL A
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEEKIKSVGGACVLVA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_RAT (60S ribosomal protein L27a OS=Rattus norvegicus GN=Rpl27a PE=1 SV=3)

HSP 1 Score: 90.8929 bits (224), Expect = 1.374e-17
Identity = 46/85 (54.12%), Postives = 61/85 (71.76%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDN---VPMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            RN+  CP VN+DKLW++V +  +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL A
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKNGVAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148          
BLAST of DC900349 vs. ExPASy Swiss-Prot
Match: RL27A_MACFA (60S ribosomal protein L27a OS=Macaca fascicularis GN=RPL27A PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.374e-17
Identity = 46/85 (54.12%), Postives = 61/85 (71.76%), Query Frame = 2
Query:    5 RNKFHCPIVNIDKLWSMVPQDVKAKASKDNV---PMIDVTQFGYFKVLGKGVLPENQPVVVKAKLVSKTAEKKIKEAGGAVVLTA 250
            RN+  CP VN+DKLW++V +  +  A+K+     P+IDV + GY+KVLGKG LP+ QPV+VKAK  S+ AE+KIK  GGA VL A
Sbjct:   65 RNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVVRSGYYKVLGKGKLPK-QPVIVKAKFFSRRAEEKIKGVGGACVLVA 148          
The following BLAST results are available for this feature:
BLAST of DC900349 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 24
Match NameE-valueIdentityDescription
R27A2_ARATH9.469e-3585.5460S ribosomal protein L27a-2 OS=Arabidopsis thalia... [more]
R27A3_ARATH2.109e-3484.3460S ribosomal protein L27a-3 OS=Arabidopsis thalia... [more]
RL27A_TETTH5.958e-2163.1060S ribosomal protein L27a OS=Tetrahymena thermoph... [more]
RL27A_OSCBR8.604e-2054.8860S ribosomal protein L27a OS=Oscheius brevesophag... [more]
RL27A_DICDI1.124e-1952.3360S ribosomal protein L27a OS=Dictyostelium discoi... [more]
RL27A_EUPCR9.513e-1955.2960S ribosomal protein L27a OS=Euplotes crassus GN=... [more]
RL27A_PONAB8.053e-1854.1260S ribosomal protein L27a OS=Pongo abelii GN=RPL2... [more]
RL27A_HUMAN8.053e-1854.1260S ribosomal protein L27a OS=Homo sapiens GN=RPL2... [more]
RL27A_RAT1.374e-1754.1260S ribosomal protein L27a OS=Rattus norvegicus GN... [more]
RL27A_MACFA1.374e-1754.1260S ribosomal protein L27a OS=Macaca fascicularis ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900349 VSS Citrus sinensis cDNA clone VS28908 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900349 ID=DC900349|Name=DC900349|organism=Citrus sinensis|type=EST|length=1064bp
ACTCCGCAACAAATTCCACTGCCCCATCGTCAACATCGACAAGCTCTGGT
CCATGGTCCCGCAAGATGTGAAAGCAAAGGCCAGCAAGGACAATGTTCCG
ATGATTGATGTCACTCAGTTCGGCTACTTTAAGGTTTTGGGCAAAGGTGT
TTTGCCGGAGAACCAGCCCGTCGTTGTCAAGGCCAAGCTCGTTTCTAAGA
CCGCTGAGAAGAAGATCAAAGAGGCTGGTGGCGCTGTTGTGCTCACAGCT
TAGGGTTATTTTGGTAACTCTCCCTTGTCTAGGGATTTTGTTTTATTCTG
GGATCTGTTGAGACTTATTTAAATCACAATGTTTTTATCTTTTTTTTTGG
GTATATCTCTCGCTTAATGATTAAATGTGACCTGAATCTCATTTTATTTG
ACTTCTTGGTGCATTTAAGCAGTTTTTTATAAAAAAGAAGCCTCAAATTA
AAGCTTTGTTTGGCATAATTAATCTCTCTCCCCATTTTCTTCTTATCTTG
GCTAATTAAACCTCCACTTTCATCATTCATGGCACAAAAAATTTTCATGT
TAACTCTCCTTGTGGTTCTCCTCCTAAGCAAAAGCTTTGATTTAATATCA
GCATCAAGGCCACCTCATATTCACCCACCAACTATCCCTAGAGGCTCTTT
GTTGAACAAGGTTAAACCTCCTTCTTTTCATGCATATACTGCAAATCGTT
ACAAGTTGACAGAATCAGAGGCTTTTCGCCCCACGAGTCCGGGACATAGC
CCTGGTGTTGGCCACAAAGGACCACCGGGTTCTGATTGAAGTAAGCCCTA
GCTAGCAGCACAGCTTGTTAGGTTTTCATATAGTATACACTTAAAATGAT
TGTTGTTTAAAAGATTGCTCATATGCATGCAACCAAATAATATGTCTTCT
AAAGGGTCCTCTCAAGTCTTGTTGACGAGTTAGGTTTTCAAATAGTTGAC
ATGCCACGGTATGAAGTTATATCTATGTGTAAACCAGATTTTGTTTATCA
TTGTTTTTGCTTTGAGCTCAACTCATATTATCGCTTTATATATTTTTGTT
TTGATGGGTATTTC
back to top