DC900347

Overview
NameDC900347
Unique NameDC900347
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length654
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9863 contig Csv1_Contig9863:489..1142. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900347 vs. ExPASy Swiss-Prot
Match: PTBP3_ARATH (Polypyrimidine tract-binding protein homolog 3 OS=Arabidopsis thaliana GN=At1g43190 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.077e-25
Identity = 55/69 (79.71%), Postives = 65/69 (94.20%), Query Frame = 1
Query:    1 QDVTEEEIVSHLEEHGTIVNTKLFEMNGKKQALVLFETEEQAXEALVCKHASSLGGSIIRISFSQLQSI 207
            QDVTEEE+++H++EHG +VNTK+FEMNGKKQALV FE EE+A EALVCKHA+SLGGSIIRISFSQLQ+I
Sbjct:  364 QDVTEEEVMNHVQEHGAVVNTKVFEMNGKKQALVQFENEEEAAEALVCKHATSLGGSIIRISFSQLQTI 432          
The following BLAST results are available for this feature:
BLAST of DC900347 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PTBP3_ARATH1.077e-2579.71Polypyrimidine tract-binding protein homolog 3 OS=... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900347 VSS Citrus sinensis cDNA clone VS28904 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900347 ID=DC900347|Name=DC900347|organism=Citrus sinensis|type=EST|length=654bp
CAAGATGTTACTGAAGAGGAAATTGTGAGCCACCTGGAGGAGCATGGCAC
CATTGTGAATACCAAGCTCTTTGAGATGAATGGGAAGAAGCAGGCCTTGG
TCCTCTTTGAAACCGAGGAGCAGGCCNCTGAAGCCCTTGTGTGCAAGCAT
GCTAGCTCACTTGGCGGGTCTATAATCCGAATCTCCTTCTCCCAGTTACA
GTCAATAAGGGAAAACTCNCAGTAAAACATTGACTATTTGCTAAGCCACG
TGAGTTAAGGATTCATATAAACAAGGACATTTTGATGTAGGTGAACAGTC
TCCTTCGATGTTATCTCTTGTAACAGTAGTTTTGCTTATTTTGCGTTGGT
GGATGCGTTTTCATTTTCTTTTTATCTTTATTTCANATCATTTCTAGNGC
ATGTACTGGCTACCCTTTTTTTAGGTTTGTTTAATTTGAGGTAGATTTTT
GCAGATTTGGTCAATTTGAAGAGTANAAANANANAGAGAATTGTACTNCC
TTTTCCTGAGCTAGGGCTTTCAAAGTTTCATGTATTATTAGTTGTAAATA
TCTTTGTATTTCATGCTGATGGGGTTGGTACTGTTGTATTCTGAATTCAT
AAACCAAACCTCATTTGTCCCAGTTGATTTATGATCTAAAAAGAATTTTG
CTTC
back to top