DC900346

Overview
NameDC900346
Unique NameDC900346
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length848
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP3_ARATH (Polypyrimidine tract-binding protein homolog 3 OS=Arabidopsis thaliana GN=At1g43190 PE=2 SV=1)

HSP 1 Score: 421.394 bits (1082), Expect = 3.148e-117
Identity = 205/249 (82.33%), Postives = 222/249 (89.16%), Query Frame = 2
Query:    2 NALQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAGVAFPQMXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            +ALQF+TNVQPTIRGRNVYVQFSSHQELTT+EQN  GR DEPNRILLVTIHHMLYPITV+VLHQVFSP+GFVEK+VTFQKSAGFQALIQYQ++  A  AR++LQGRNIYDGCCQLDIQFSNL+ELQVNYNN+RSRD+TNPNLPAEQKGR S   Y + GVA+PQM         FGGGLPPGITGTNDRCTVLVSNLN+D IDEDKLFNL SLYGNI+RIKLLRNKPDHAL QMGDG QAELA HFLKG
Sbjct:   56 SALQFFTNVQPTIRGRNVYVQFSSHQELTTIEQNIHGREDEPNRILLVTIHHMLYPITVDVLHQVFSPYGFVEKLVTFQKSAGFQALIQYQVQQCAASARTALQGRNIYDGCCQLDIQFSNLEELQVNYNNDRSRDYTNPNLPAEQKGRSSHPCYGDTGVAYPQMANTSAIAAAFGGGLPPGITGTNDRCTVLVSNLNADSIDEDKLFNLFSLYGNIVRIKLLRNKPDHALVQMGDGFQAELAVHFLKG 304          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP1_HUMAN (Polypyrimidine tract-binding protein 1 OS=Homo sapiens GN=PTBP1 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 8.752e-43
Identity = 105/289 (36.33%), Postives = 154/289 (53.29%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR--------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPA-EQKGRPSQSGYSEAGVAFPQ---------MXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +YT+V P +RG+ +Y+QFS+H+EL T     Q R                                G  P  +L + + ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    SA  A+ SL G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+ + +    Q+  +  G++ P          +          G    PG+ G  +   +LVSNLN +R+    LF L  +YG++ R+K+L NK ++AL QM DG QA+LA   L G
Sbjct:  111 VNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSP--VLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGN-SVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGNQAQLAMSHLNG 396          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP1_BOVIN (Polypyrimidine tract-binding protein 1 OS=Bos taurus GN=PTBP1 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.143e-42
Identity = 105/289 (36.33%), Postives = 154/289 (53.29%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR--------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPA-EQKGRPSQSGYSEAGVAFPQ---------MXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +YT+V P +RG+ +Y+QFS+H+EL T     Q R                                G  P  +L + + ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    SA  A+ SL G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+ + +    Q+  +  G++ P          +          G    PG+ G  +   +LVSNLN +R+    LF L  +YG++ R+K+L NK ++AL QM DG QA+LA   L G
Sbjct:  111 VNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSP--VLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGN-SVLLVSNLNPERVTPQSLFILFGVYGDVQRVKVLFNKKENALVQMADGSQAQLAMSHLNG 396          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP1_MOUSE (Polypyrimidine tract-binding protein 1 OS=Mus musculus GN=Ptbp1 PE=1 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 2.816e-41
Identity = 101/281 (35.94%), Postives = 150/281 (53.38%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR--------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPA-EQKGRPSQSGYSEAGVAFPQMXXXXXXXXXFGGGLP--------PGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAEL 727
            + +YT+V P +RG+ +Y+QFS+H+EL T     Q R                                G  P  +L + + ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    SA  A+ SL G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+ + +    Q+  +  G++ P +                       PG+ G  +   +LVSNLN +R+    LF L  +YG++ R+K+L NK ++AL QM DG QA+L
Sbjct:  110 VNYYTSVAPVLRGQPIYIQFSNHKELKTDSSPNQVRAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSP--VLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGLSVPNVHGALAPLAIPSAAAAAAASRIAIPGLAGAGN-SVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVQMADGSQAQL 387          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP1_RAT (Polypyrimidine tract-binding protein 1 OS=Rattus norvegicus GN=Ptbp1 PE=1 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 6.272e-41
Identity = 109/314 (34.71%), Postives = 155/314 (49.36%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR--------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQK---------------GRPSQSGY-----------SEAGVAFPQ---------MXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +YT+V P +RG+ +Y+QFS+H+EL T     Q R                                G  P  +L + + ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    SA  A+ SL G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+                  G  S S Y           S AG++ P          +          G    PG+ G  +   +LVSNLN +R+    LF L  +YG++ R+K+L NK ++AL +M DG QA+LA   L G
Sbjct:  110 VNYYTSVAPVLRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSP--VLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPSLDQTMAAAFGAPGIMSASPYAGAVPSHLCHPSRAGLSVPNVHGALAPLAIPSAAAAAAAAGRIAIPGLAGAGN-SVLLVSNLNPERVTPQSLFILFGVYGDVQRVKILFNKKENALVEMADGSQAQLAMSHLNG 420          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP1_PIG (Polypyrimidine tract-binding protein 1 OS=Sus scrofa GN=PTBP1 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.383e-40
Identity = 110/315 (34.92%), Postives = 154/315 (48.89%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR--------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQK---------------GRPSQSGYSEAG----VAFPQ-----------------MXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +YT+V P +RG+ +Y+QFS+H+EL T     Q R                                G  P  +L + + ++ YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    SA  A+ SL G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+                  G  S S Y+ AG     A PQ                 +          G    PG+ G  +   +LVSNLN +R+    LF L  +Y ++ R+K+L NK ++AL QM DG QA+LA   L G
Sbjct:  111 VNYYTSVTPVLRGQPIYIQFSNHKELKTDSSPNQARAQAALQAVNSVQSGNLALAASAAAVDAGMAMAGQSP--VLRIIVENLFYPVTLDVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDNQPSLDQTMAAAFGAPGIMSASPYAGAGFPPTFAIPQAATVSVPNVHGALAPLAIPSAAARAAAAGRIAIPGLAGAGN-SVLLVSNLNPERVTPQSLFILFGVYCDVQRVKILFNKKENALVQMADGSQAQLAMSHLNG 422          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP2_RAT (Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus GN=Ptbp2 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.545e-39
Identity = 102/292 (34.93%), Postives = 150/292 (51.37%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQEL-----------------------------TTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAG----------------VAFPQMXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +Y+ V P +R + +Y+Q+S+H+EL                             TT+ ++A      P  +L + I +M YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    +A  A+ +L G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+   G+P+      A                 +A P              G+P    G N    +LVSNLN + +    LF L  +YG++ R+K+L NK D AL QM DG Q++LA + L G
Sbjct:  111 VNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSP--VLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGD-GQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGN--TVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNG 397          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP2_MOUSE (Polypyrimidine tract-binding protein 2 OS=Mus musculus GN=Ptbp2 PE=1 SV=2)

HSP 1 Score: 163.31 bits (412), Expect = 1.545e-39
Identity = 102/292 (34.93%), Postives = 150/292 (51.37%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQEL-----------------------------TTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAG----------------VAFPQMXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +Y+ V P +R + +Y+Q+S+H+EL                             TT+ ++A      P  +L + I +M YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    +A  A+ +L G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+   G+P+      A                 +A P              G+P    G N    +LVSNLN + +    LF L  +YG++ R+K+L NK D AL QM DG Q++LA + L G
Sbjct:  111 VNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQVVLQAVTAVQTANTPLSGTTVSESAVTPAQSP--VLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGD-GQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGN--TVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNG 397          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: PTBP2_HUMAN (Polypyrimidine tract-binding protein 2 OS=Homo sapiens GN=PTBP2 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.545e-39
Identity = 102/292 (34.93%), Postives = 150/292 (51.37%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQEL-----------------------------TTMEQNAQGRGDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPSQSGYSEAG----------------VAFPQMXXXXXXXXXFGGGLPPGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +Y+ V P +R + +Y+Q+S+H+EL                             TT+ ++A      P  +L + I +M YP+T++VLHQ+FS  G V KI+TF K+  FQAL+QY    +A  A+ +L G+NIY+ CC L I FS L  L V YNN++SRD+T P+LP+   G+P+      A                 +A P              G+P    G N    +LVSNLN + +    LF L  +YG++ R+K+L NK D AL QM DG Q++LA + L G
Sbjct:  111 VNYYSAVTPHLRNQPIYIQYSNHKELKTDNTLNQRAQAVLQAVTAVQTANTPLSGTTVSESAVTPAQSP--VLRIIIDNMYYPVTLDVLHQIFSKFGAVLKIITFTKNNQFQALLQYGDPVNAQQAKLALDGQNIYNACCTLRIDFSKLVNLNVKYNNDKSRDYTRPDLPSGD-GQPALDPAIAAAFAKETSLLAVPGALSPLAIPNAAAAAAAAAAGRVGMPGVSAGGN--TVLLVSNLNEEMVTPQSLFTLFGVYGDVQRVKILYNKKDSALIQMADGNQSQLAMNHLNG 397          
BLAST of DC900346 vs. ExPASy Swiss-Prot
Match: ROD1_MOUSE (Regulator of differentiation 1 OS=Mus musculus GN=Rod1 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.495e-39
Identity = 109/310 (35.16%), Postives = 153/310 (49.35%), Query Frame = 2
Query:    8 LQFYTNVQPTIRGRNVYVQFSSHQELTTMEQNAQGR------------------------------GDEPNRILLVTIHHMLYPITVEVLHQVFSPHGFVEKIVTFQKSAGFQALIQYQLRPSAVVARSSLQGRNIYDGCCQLDIQFSNLDELQVNYNNERSRDFTNPNLPAEQKGRPS---------------QSGYSEA-----GVAFPQ------------MXXXXXXXXXFGGGLP-PGITGTNDRCTVLVSNLNSDRIDEDKLFNLXSLYGNIIRIKLLRNKPDHALXQMGDGXQAELAXHFLKG 748
            + +YT V P +R + VY+Q+S+H+EL T     Q R                              G  P  +L + I ++ YP+T+EVLHQ+FS  G V KI+TF K+  FQAL+QY    +A  A+ +L G+NIY+ CC L I FS L  L V YNN++SRDFT  +LP    G+PS                S Y+ A      +AFPQ            +           G +  PG +G      +LV+NLN D I    LF L  +YG++ R+K++ NK ++AL QM D  QA+LA + L G
Sbjct:   82 INYYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNLSLPGATANEGTLLPGQSP--VLRIIIENLFYPVTLEVLHQIFSKFGTVLKIITFTKNNQFQALLQYADPVNAQYAKMALDGQNIYNACCTLRIDFSKLTSLNVKYNNDKSRDFTRLDLPTGD-GQPSLEPPMAAAFGAPGIMSSPYAGAAGFAPAIAFPQAAGLSVPAVPGALGPLTLTSSAVSGRMAIPGASGMPGNSVLLVTNLNPDFITPHGLFILFGVYGDVHRVKIMFNKKENALVQMADASQAQLAMNHLSG 388          
The following BLAST results are available for this feature:
BLAST of DC900346 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 18
Match NameE-valueIdentityDescription
PTBP3_ARATH3.148e-11782.33Polypyrimidine tract-binding protein homolog 3 OS=... [more]
PTBP1_HUMAN8.752e-4336.33Polypyrimidine tract-binding protein 1 OS=Homo sap... [more]
PTBP1_BOVIN1.143e-4236.33Polypyrimidine tract-binding protein 1 OS=Bos taur... [more]
PTBP1_MOUSE2.816e-4135.94Polypyrimidine tract-binding protein 1 OS=Mus musc... [more]
PTBP1_RAT6.272e-4134.71Polypyrimidine tract-binding protein 1 OS=Rattus n... [more]
PTBP1_PIG2.383e-4034.92Polypyrimidine tract-binding protein 1 OS=Sus scro... [more]
PTBP2_RAT1.545e-3934.93Polypyrimidine tract-binding protein 2 OS=Rattus n... [more]
PTBP2_MOUSE1.545e-3934.93Polypyrimidine tract-binding protein 2 OS=Mus musc... [more]
PTBP2_HUMAN1.545e-3934.93Polypyrimidine tract-binding protein 2 OS=Homo sap... [more]
ROD1_MOUSE4.495e-3935.16Regulator of differentiation 1 OS=Mus musculus GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900346 VSS Citrus sinensis cDNA clone VS28904 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900346 ID=DC900346|Name=DC900346|organism=Citrus sinensis|type=EST|length=848bp
CAATGCTCTGCAATTTTACACGAATGTGCAGCCAACCATCAGGGGAAGGA
ATGTTTATGTCCAATTTTCATCACATCAGGAACTAACAACAATGGAACAG
AATGCTCAAGGACGAGGTGATGAGCCGAACCGAATTCTCTTAGTTACAAT
TCATCACATGCTTTATCCTATTACTGTGGAAGTGCTGCATCAAGTTTTTT
CTCCTCATGGATTTGTGGAAAAGATCGTCACATTCCAGAAGTCAGCTGGA
TTTCAAGCACTTATCCAGTATCAATTACGTCCGAGTGCTGTTGTAGCTAG
AAGTTCTCTTCAGGGTCGTAATATTTATGATGGTTGCTGTCAGCTGGACA
TTCAATTCTCAAACCTTGATGAGTTACAAGTGAACTACAATAATGAGCGA
TCAAGGGACTTCACAAATCCAAATCTTCCTGCAGAACAGAAAGGCAGACC
CTCACAATCTGGGTACAGCGAAGCAGGAGTTGCATTTCCACAGATGGCCA
ATGCAGCTGCAATTGCAGCCGCCTTTGGCGGAGGTCTACCTCCTGGAATA
ACAGGGACAAATGATAGGTGTACAGTCTTAGTTTCCAATCTCAATTCTGA
TAGAATAGATGAGGATAAGCTTTTTAACTTGNTCTCCCTCTATGGAAATA
TCATAAGAATCAAACTCCTCCGCAATAAACCAGATCATGCTCTTGNTCAG
ATGGGCGATGGCTTNCAGGCTGAATTGGCGGNGCACTTTCTGAAGGGGNC
TTACTNTTGGGAAGCGATTAGAGGTCACTTNTTTAGCATCCCATATACCT
CAGGNGCTGCCCCATGATCATGACTCGACCTTACCGTTTAACGTATGC
back to top