DC900343

Overview
NameDC900343
Unique NameDC900343
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length796
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5658 contig Csv1_Contig5658:1..796. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900343 vs. ExPASy Swiss-Prot
Match: C3H6_ARATH (Zinc finger CCCH domain-containing protein 6 OS=Arabidopsis thaliana GN=At1g19860 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 2.306e-26
Identity = 73/154 (47.40%), Postives = 87/154 (56.49%), Query Frame = 3
Query:   93 TSNGGFYAQANGVGVGHHPNSWIKXXXXXXXXXXXXFGPSQPRDLNYYKNLIQQHGGDRQET--LQQFGNRLSHQQPG-TSQEFVN----NPKSRDSKPKIMKPCIYFNSSRGCRHGSKCAYQHDTSSQQRSN------NMPEGQNAKRMKLDR 515
            +SNG FYAQ     + H P                 +G    RD +YYKNLIQQHGGDRQET  +Q  G R + Q  G  + E VN    N + RDSKPKIMK C+YFNS+RGCRHG+ C YQHD +  Q  N      N  + QNAKRM+ DR
Sbjct:  265 SSNGQFYAQPP---ITHIPPM---AYTPHAPQDQPNYGAPPARDASYYKNLIQQHGGDRQETPPVQHLGYRYNLQPGGGPNPEMVNSSNNNQRPRDSKPKIMKACMYFNSARGCRHGANCMYQHDATPYQPRNLNNGNINTSDMQNAKRMRFDR 412          
BLAST of DC900343 vs. ExPASy Swiss-Prot
Match: C3H30_ORYSJ (Zinc finger CCCH domain-containing protein 30 OS=Oryza sativa subsp. japonica GN=Os04g0663200 PE=2 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 1.402e-15
Identity = 46/113 (40.71%), Postives = 68/113 (60.18%), Query Frame = 3
Query:  201 FGPSQPRDLNYYKNLIQQHGGDR-QETLQQFGNRLS-HQQPGTSQ----EFVNNPK---SRDSKPKIMKPCIYFNSSRGCRHGSKCAYQHDTSSQQRSNNMPEGQNAKRMKLD 512
            FG    R + YYK LI QHGG+R ++  +Q G +   ++QPG  Q    + +N      SRD K + MKPC YFNS +GCR+G+ C + HD S+  R ++  + + +KR+KLD
Sbjct:  351 FGSVPGRGVGYYKTLIHQHGGERLEQPFEQHGMQFGMYRQPGPPQNGGIDAMNGAAAMVSRDGKVRPMKPCAYFNSPKGCRNGASCTFLHDASAPTRKDHQKQ-KGSKRIKLD 462          
The following BLAST results are available for this feature:
BLAST of DC900343 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
C3H6_ARATH2.306e-2647.40Zinc finger CCCH domain-containing protein 6 OS=Ar... [more]
C3H30_ORYSJ1.402e-1540.71Zinc finger CCCH domain-containing protein 30 OS=O... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900343 VSS Citrus sinensis cDNA clone VS28695 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900343 ID=DC900343|Name=DC900343|organism=Citrus sinensis|type=EST|length=796bp
CAGATCATCATCCTCCTCCAGTAGCAGTATCAGATCCTTCTTCTGTACGC
TTCAATATGATGGAAACCAGTTCACCTTCATTGGTGGCTACTACTTCAAA
TGGAGGTTTTTATGCTCAAGCAAATGGTGTTGGAGTAGGGCATCATCCTA
ACTCATGGATTAAACCACCTGGGGTTGTTCCAGCTTCAGCATCTCCTTCC
TTTGGACCTTCTCAACCAAGAGACTTGAACTACTATAAGAACTTGATTCA
GCAACATGGAGGAGATAGACAAGAAACCTTGCAGCAGTTTGGTAACCGAC
TCAGTCACCAACAACCGGGGACAAGCCAAGAATTCGTAAATAATCCCAAA
TCAAGAGACTCGAAACCCAAAATAATGAAGCCTTGTATTTATTTTAATAG
TTCAAGGGGATGCCGGCATGGATCCAAATGTGCGTACCAGCATGATACAT
CGTCCCAGCAACGGAGCAATAACATGCCCGAGGGCCAAAATGCAAAGAGA
ATGAAACTGGATAGGCAGATTAGCAGCTGACGTTTTGTTCCTATTGGGTG
TGGGCATTTTGAGTGAGAGGCTGATTCAGTTTAAAGAGAGAATAGTAGCA
CAAAATTCACTGTTGCCAAATAGTGTAATTTTGAGTGTTCCCTTCCATGC
TTTTCCTTGCACTACTGATGATGGTCTTCGAGATACGGGTTATGGGAGGA
GCTATTTTTCATCACAATCTCAGCCGAGGATTTTGATAATTGTAATGACC
CTGTCCTTTTAAAAAATTTTCTATTCTACCCCTTCAAAGTTGTAAT
back to top