DC900341

Overview
NameDC900341
Unique NameDC900341
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1583
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5657 contig Csv1_Contig5657:1..1588. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: COGT2_ARATH (Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.919e-76
Identity = 74/146 (50.68%), Postives = 102/146 (69.86%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALA-ELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLM 1263
            K   +V+Y++FGSIT+L   QL+EF  GL  S + FLWVIRPD V GE   +  + +  TK+R +L SW PQE+VL+H A+ GFLTH GWNS LES+  GVPM+CWP+FADQQ+N +F  + W++G+++     R  VE +V +LM
Sbjct:  295 KTQNSVIYINFGSITVLSVKQLVEFAWGLAGSGKEFLWVIRPDLVAGEEAMVPPDFLMETKDRSMLASWCPQEKVLSHPAIGGFLTHCGWNSILESLSCGVPMVCWPFFADQQMNCKFCCDEWDVGIEIGGDVKREEVEAVVRELM 440          

HSP 2 Score: 137.117 bits (344), Expect = 2.919e-76
Identity = 81/244 (33.20%), Postives = 131/244 (53.69%), Query Frame = 3
Query:    3 HILIFPLPCQSHMNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHXRFLQYSEFQFKTISDGLPADHPRAGDQLMEMFDSLSLNTRPLLKQMLI-----DTSPPVSCIIGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPM-------KAYDEDTDRLITKVPGMETFLRFRDLPSFCRVSDVTDRDLQVLKNATQQSPRAHALILNTFEDLEEPILSHIRTNXP 698
            H++  P P Q H+N M+++A++    G  VTF+N+ +NH R +R    +        F+F++I+DGLP     A   +  + +S   N     +++L      D  PPVSCI+ D CM F +DVA EL +P + F   S C+F AY      I+ G  P+       K Y EDT  +I  +P M+  ++ +D+PSF R ++  D  +      T+++ RA A+ILNTF+DLE  ++  +++  P
Sbjct:   13 HVVCVPYPAQGHINPMMRVAKLLHARGFYVTFVNTVYNHNRFLRSRGSNA-LDGLPSFRFESIADGLPETDMDATQDITALCESTMKNCLAPFRELLQRINAGDNVPPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLCPLKDESYLTKEYLEDT--VIDFIPTMKN-VKLKDIPSFIRTTNPDDVMISFALRETERAKRASAIILNTFDDLEHDVVHAMQSILP 252          

HSP 3 Score: 32.7278 bits (73), Expect = 2.919e-76
Identity = 14/43 (32.56%), Postives = 23/43 (53.49%), Query Frame = 2
Query:  695 PKVYTIGPLHLQLKTGFAST*SHRHFKVSNSLWEXDRSCIEWL 823
            P VY++GPLHL                +S++LW+ +  C++WL
Sbjct:  252 PPVYSVGPLHLLANREIEE--GSEIGMMSSNLWKEEMECLDWL 292          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: HMNGT_SORBI (Cyanohydrin beta-glucosyltransferase OS=Sorghum bicolor GN=UGT85B1 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 2.730e-59
Identity = 70/193 (36.27%), Postives = 104/193 (53.89%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAE--LVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLMV-ERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDIKMMSSQ 1398
            KP  +V+YV+FGS+ ++   Q  EF  GL      FLWV RPD V GE   L E  L E  + RGL+V W PQ  VL H AV  F++H GWNS LE+  AG P++ WP   +Q  N R + EVW  G  +    +   V ++V ++MV +  +E                 +GG S+ N++R+++D+ ++  +
Sbjct:  299 KPAGSVVYVNFGSMAVMTAAQAREFALGLASCGSPFLWVKRPDVVEGEEVLLPEALLDEVARGRGLVVPWCPQAAVLKHAAVGLFVSHCGWNSLLEATAAGQPVLAWPCHGEQTTNCRQLCEVWGNGAQLPREVESGAVARLVREMMVGDLGKEKRAKAAEWKAAAEAAARKGGASWRNVERVVNDLLLVGGK 491          

HSP 2 Score: 116.701 bits (291), Expect = 2.730e-59
Identity = 73/248 (29.44%), Postives = 126/248 (50.81%), Query Frame = 3
Query:    3 HILIFPLPCQSHMNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTD---IHXRFLQYSEFQFKTISDGLPADHPRAGDQLMEMFDSLSLNT----RPLLKQMLIDT----SPPVSCIIGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMK-----AYDEDTDRLITKVPGMETFLRFRDLPSFCRVSDVTDRDLQVLKNATQQSPRAHALILNTFEDLEEPILSHIRTNXP 698
            H+++ P P Q H+  +++LA +    G +VTF+ +++N+ RL+R      +       + F+ + I DGL    P+  + +  + DSL  N     R LL+++  +     +PPV+C++GD  M F    A E  IP + F   SAC    Y    E+++ G +P +     A D+  D  +  VPGM + +R RD+P+FCR +D  D  +       + +  + ALILNT  +LE+ ++  +    P
Sbjct:   12 HVVLVPFPGQGHVAPLMQLARLLHARGARVTFVYTQYNYRRLLRAKGEAAVRPPATSSARFRIEVIDDGLSLSVPQ--NDVGGLVDSLRKNCLHPFRALLRRLGQEVEGQDAPPVTCVVGDVVMTFAAAAAREAGIPEVQFFTASACGLLGYLHYGELVERGLVPFRDASLLADDDYLDTPLEWVPGM-SHMRLRDMPTFCRTTDPDDVMVSATLQQMESAAGSKALILNTLYELEKDVVDALAAFFP 256          

HSP 3 Score: 30.4166 bits (67), Expect = 2.730e-59
Identity = 15/51 (29.41%), Postives = 27/51 (52.94%), Query Frame = 2
Query:  695 PKVYTIGPLHLQLKTGFAST*SHRHFKVSNSLWEXDRSCIEWL-GKSLGGL 844
            P +YT+GPL   + +  +++       +S  +W+ D  C+ WL GK  G +
Sbjct:  256 PPIYTVGPLAEVIASSDSASAGLAAMDIS--IWQEDTRCLSWLDGKPAGSV 304          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: CNGT1_ARATH (Cytokinin-N-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT76C1 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.765e-50
Identity = 86/189 (45.50%), Postives = 113/189 (59.79%), Query Frame = 1
Query:  838 RAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKE----RGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLMVERK-EEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDIKMM 1389
            R+V+YVS GSI  L     +E   GL ++ Q FLWV+RP SV G  D +  L  G  E    +G +V W PQ +VLAH+A  GFLTH+GWNSTLESI  GVPMIC P   DQ +N+RF+SEVW +G+ ++   +R  +E+ V  LMVE K EE                 +GG SY +LD L+D I ++
Sbjct:  270 RSVVYVSLGSIASLNESDFLEIACGLRNTNQSFLWVVRPGSVHGR-DWIESLPSGFMESLDGKGKIVRWAPQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGRIERREIERAVIRLMVESKGEEIRGRIKVLRDEVRRSVKQGGSSYRSLDELVDRISII 457          

HSP 2 Score: 60.8474 bits (146), Expect = 1.765e-50
Identity = 54/226 (23.89%), Postives = 99/226 (43.81%), Query Frame = 3
Query:    6 ILIFPLPCQSHMNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHXRFLQYSEFQFKTISDGLPADHPRAGDQLMEMF---DSLSLNTRPLLKQMLIDTSPP------VSCIIGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDTDRLITKVPGMETFLRFRDLPSFCRVS-DVTDRDLQVLKNATQQSPRAHALILNTFE 653
            +++FPLP Q  +N ML+LA+I    G  +T ++++ N  +             +  F F  I DGL     ++ D L+++    ++  +  R  L +++  +S        +SC+I D+   F   VA    +P     A     F  +F +P++ + G LP+   D + D L+ + P     LR +DL      S      D  +LK      P +  ++++  E
Sbjct:    9 VILFPLPLQGCINPMLQLAKILYSRGFSITIIHTRFNAPKSS----------DHPLFTFLQIRDGLSESQTQSRDLLLQLTLLNNNCQIPFRECLAKLIKPSSDSGTEDRKISCVIDDSGWVFTQSVAESFNLPRFVLCAYKFSFFLGHFLVPQIRREGFLPVP--DSEADDLVPEFPP----LRKKDLSRIMGTSAQSKPLDAYLLKILDATKPASGIIVMSCKE 218          

HSP 3 Score: 27.335 bits (59), Expect = 1.765e-50
Identity = 15/41 (36.59%), Postives = 20/41 (48.78%), Query Frame = 2
Query:  701 VYTIGPLHLQLKTGFAST*SHRHFKVSNSLWEXDRSCIEWL 823
            ++ IGP H+           H     S+SL E D+SCI WL
Sbjct:  235 IFPIGPFHI-----------HDVPASSSSLLEPDQSCIPWL 264          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: CNGT2_ARATH (Cytokinin-N-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT76C2 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.886e-49
Identity = 79/188 (42.02%), Postives = 117/188 (62.23%), Query Frame = 1
Query:  838 RAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEG--DALAE-LVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRNVVEKMVNDLMVERK-EEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDIKMM 1389
            ++V+YVS GS+  +   + +E   GL +SKQ FLWV+RP SV+G    + L+E LV   +E+G +V W PQ+EVLAH+A  GFLTH+GWNSTLESI  GVPMIC P   DQ +NSRFVS++W +G+ ++   ++  +EK V  LM E +  +                 +GG S+ +++ L + I ++
Sbjct:  263 KSVIYVSLGSVVNITETEFLEIACGLSNSKQPFLWVVRPGSVLGAKWIEPLSEGLVSSLEEKGKIVKWAPQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQMLNSRFVSDIWKIGIHLEGRIEKKEIEKAVRVLMEESEGNKIRERMKVLKDEVEKSVKQGGSSFQSIETLANHILLL 450          

HSP 2 Score: 63.5438 bits (153), Expect = 1.886e-49
Identity = 60/231 (25.97%), Postives = 106/231 (45.89%), Query Frame = 3
Query:    6 ILIFPLPCQSHMNSMLKLAEIFGLAGLKVTFLNSKHNHERLIRYTDIHXRFLQYSEFQFKTISDGLPADHPRAGDQLMEMFDSLSLNT----RPLLKQMLIDT--SPPVSCIIGDACMEFVVDVATELEIPVIHFRAISACSFWAYFSIPEMIQAGELPMKAYDEDTDRLITKVPGMETFLRFRDLPS-FCRVSDVTDRDLQVLKNATQQSPRAHALILNTFEDLEEPILS 677
            +++FPLP Q  +N ML+LA I  + G  +T ++++ N  +             +  F F  I DGL        D +M +   ++LN     R  L+++L+++  S  V+C+I D    F   V+  L++P +      A  F AY S+P +   G LP+   + + +  + + P ++     RDL   F    +  D  L  +   T    R+  LI  + E+LE+  L+
Sbjct:   10 VILFPLPLQGCINPMLQLANILHVRGFSITVIHTRFNAPKAS----------SHPLFTFLQIPDGL--SETEIQDGVMSLLAQINLNAESPFRDCLRKVLLESKESERVTCLIDDCGWLFTQSVSESLKLPRLVLCTFKATFFNAYPSLPLIRTKGYLPVS--ESEAEDSVPEFPPLQK----RDLSKVFGEFGEKLDPFLHAVVETT---IRSSGLIYMSCEELEKDSLT 219          

HSP 3 Score: 24.2534 bits (51), Expect = 1.886e-49
Identity = 16/54 (29.63%), Postives = 25/54 (46.30%), Query Frame = 2
Query:  668 NSVTYTHQXPKV--YTIGPLHLQLKTGFAST*SHRHFKVSNSLWEXDRSCIEWL 823
            +S+T +++  KV  + IGP H                  S+SL+  D +CI WL
Sbjct:  216 DSLTLSNEIFKVPVFAIGPFHSYFSAS------------SSSLFTQDETCILWL 257          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: Y1567_ARATH (Uncharacterized UDP-glucosyltransferase At1g05670 OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.226e-26
Identity = 74/187 (39.57%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAE-LVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCD----RNVVEKMVNDLM-VERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLI 1371
            K   +V+YVSFGS+ +LK  QLIE   GL  S   FLWV+R      E   L E  +E   E+GL VSW PQ EVL H+++  F+TH GWNSTLE +  GVPMI  P++ADQ  N++F+ +VW +G+ +K   D    R    + V ++M  E+ +E                +EGG S  N++  +
Sbjct:  267 KQPSSVVYVSFGSLVVLKKDQLIELAAGLKQSGHFFLWVVRET----ERRKLPENYIEEIGEKGLTVSWSPQLEVLTHKSIGCFVTHCGWNSTLEGLSLGVPMIGMPHWADQPTNAKFMEDVWKVGVRVKADSDGFVRREEFVRRVEEVMEAEQGKEIRKNAEKWKVLAQEAVSEGGSSDKNINEFV 449          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: IABG1_ARATH (Indole-3-acetate beta-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT75B1 PE=1 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.038e-25
Identity = 66/197 (33.50%), Postives = 107/197 (54.31%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVI-----RPDSVIGEGDALAELVEGTK----ERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKD----VCDRNVVEKMVNDLMVERKEEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDI 1380
            K   +V+YVSFG++  L   Q+ E    L++ K+ FLWVI     R     GE +   E + G +    E G++VSW  Q EVL+H+AV  F+TH GW+STLES+V GVP++ +P ++DQ  N++ + E W  G+ +++    + +R  + + +  +M E+  E                 EGG S  N++  ++DI
Sbjct:  255 KTESSVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGEIRRCLEAVMEEKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVEDI 451          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: HQGT_ARATH (Probable hydroquinone glucosyltransferase OS=Arabidopsis thaliana GN=At4g01070 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.355e-25
Identity = 66/134 (49.25%), Postives = 85/134 (63.43%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEG---------DALAEL----VEGTKERGLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSE 1188
            +P  +VLYVSFGS   L   QL E   GL DS+QRFLWVIR  S I            D L  L    +E TK+RG ++  W PQ +VLAH +  GFLTH GWNSTLES+V+G+P+I WP +A+Q++N+  +SE
Sbjct:  265 QPLGSVLYVSFGSGGTLTCEQLNELALGLADSEQRFLWVIRSPSGIANSSYFDSHSQTDPLTFLPPGFLERTKKRGFVIPFWAPQAQVLAHPSTGGFLTHCGWNSTLESVVSGIPLIAWPLYAEQKMNAVLLSE 398          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: ZOG_PHALU (Zeatin O-glucosyltransferase OS=Phaseolus lunatus GN=ZOG1 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.150e-25
Identity = 74/196 (37.76%), Postives = 104/196 (53.06%), Query Frame = 1
Query:  841 AVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRP----DSVIGEGDALAELVEGTKER----GLLV-SWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMKDVCDRN------VVEKMVNDLMVERK-EEFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDI 1380
            +V+Y+SFG+ T L+  Q+ +   GL  SKQ+F+WV+R     D   G      EL +G +ER    GL+V  W PQ E+L+H +  GF++H GWNS LESI  GVP+  WP  +DQ  N+  V+EV  +GL +KD   RN      VVE  V  LM  ++ +E                +EGG S+  +   I  I
Sbjct:  262 SVIYISFGTTTALRDEQIQQIATGLEQSKQKFIWVLREADKGDIFAGSEAKRYELPKGFEERVEGMGLVVRDWAPQLEILSHSSTGGFMSHCGWNSCLESITMGVPIATWPMHSDQPRNAVLVTEVLKVGLVVKDWAQRNSLVSASVVENGVRRLMETKEGDEMRQRAVRLKNAIHRSMDEGGVSHMEMGSFIAHI 457          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: UFOG7_MANES (Anthocyanidin 3-O-glucosyltransferase 7 (Fragment) OS=Manihot esculenta GN=GT7 PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.150e-25
Identity = 64/157 (40.76%), Postives = 92/157 (58.60%), Query Frame = 1
Query:  817 MAW*---KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKERGLLVSWVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGLDMK-DVCDRNVVEKMVNDLMVERK 1275
            MAW    KP  +V Y+SFGS+      +L+     L  SK  FLW ++  S +   +     ++ TK  G+++SW PQ E+L H A+  F+TH GWNS LESIV GVPMIC P+F DQ++N R V +VW +GL M   V  +N     +N ++++ K
Sbjct:   91 MAWLDKQKPA-SVAYISFGSVATPPPHELVALAEALEASKVPFLWSLKDHSKVHLPNGF---LDRTKSHGIVLSWAPQVEILEHAALGVFVTHCGWNSILESIVGGVPMICRPFFGDQRLNGRMVEDVWEIGLLMDGGVLTKNGAIDGLNQILLQGK 243          
BLAST of DC900341 vs. ExPASy Swiss-Prot
Match: FOGT1_ARATH (Flavonol-3-O-glycoside-7-O-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT73C6 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 6.726e-25
Identity = 80/214 (37.38%), Postives = 111/214 (51.87%), Query Frame = 1
Query:  829 KPGRAVLYVSFGSITLLKXXQLIEFWHGLVDSKQRFLWVIRPDSVIGEGDALAELVEGTKE---------RGLLVS-WVPQEEVLAHQAVAGFLTHSGWNSTLESIVAGVPMICWPYFADQQINSRFVSEVWNLGL--DMKDV------------CDRNVVEKMVNDLMVERKE--EFXXXXXXXXXXXXXXXNEGGPSYCNLDRLIDDIKMMS 1392
            +PG +VLYV  GSI  L   QL+E   GL +S++ F+WVIR        +   ELVE   E         RGLL+  W PQ  +L+H +V GFLTH GWNSTLE I AG+PM+ WP FADQ  N + V ++  +G+  ++K+V             D+  V+K V +LM E  +  E                 EGG S+ N+  L+ DI  ++
Sbjct:  285 EPG-SVLYVCLGSICNLPLSQLLELGLGLEESQRPFIWVIRG------WEKYKELVEWFSESGFEDRIQDRGLLIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPMLTWPLFADQFCNEKLVVQILKVGVSAEVKEVMKWGEEEKIGVLVDKEGVKKAVEELMGESDDAKERRRRAKELGESAHKAVEEGGSSHSNITFLLQDIMQLA 491          
The following BLAST results are available for this feature:
BLAST of DC900341 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
COGT2_ARATH2.919e-7650.68Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis t... [more]
HMNGT_SORBI2.730e-5936.27Cyanohydrin beta-glucosyltransferase OS=Sorghum bi... [more]
CNGT1_ARATH1.765e-5045.50Cytokinin-N-glucosyltransferase 1 OS=Arabidopsis t... [more]
CNGT2_ARATH1.886e-4942.02Cytokinin-N-glucosyltransferase 2 OS=Arabidopsis t... [more]
Y1567_ARATH1.226e-2639.57Uncharacterized UDP-glucosyltransferase At1g05670 ... [more]
IABG1_ARATH1.038e-2533.50Indole-3-acetate beta-glucosyltransferase 1 OS=Ara... [more]
HQGT_ARATH1.355e-2549.25Probable hydroquinone glucosyltransferase OS=Arabi... [more]
ZOG_PHALU5.150e-2537.76Zeatin O-glucosyltransferase OS=Phaseolus lunatus ... [more]
UFOG7_MANES5.150e-2540.76Anthocyanidin 3-O-glucosyltransferase 7 (Fragment)... [more]
FOGT1_ARATH6.726e-2537.38Flavonol-3-O-glycoside-7-O-glucosyltransferase 1 O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900341 VSS Citrus sinensis cDNA clone VS28692 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900341 ID=DC900341|Name=DC900341|organism=Citrus sinensis|type=EST|length=1583bp
CTCATATCCTGATCTTTCCTCTCCCATGCCAAAGCCATATGAATTCCATG
CTCAAGCTTGCCGAGATTTTCGGCTTAGCTGGCCTCAAAGTGACCTTCCT
AAACTCCAAGCACAACCACGAACGCCTCATCCGGTACACGGATATCCATG
ANCGTTTTCTGCAGTATTCTGAATTCCAATTTAAGACCATCTCAGATGGT
CTTCCAGCGGATCACCCACGAGCAGGTGACCAATTGATGGAGATGTTCGA
TTCTTTGAGTTTGAATACCAGGCCACTTCTCAAACAGATGCTGATTGACA
CTAGCCCGCCAGTGAGCTGCATCATTGGAGATGCATGTATGGAATTTGTG
GTAGACGTTGCTACTGAACTTGAAATCCCTGTAATCCATTTTCGTGCTAT
AAGTGCTTGTAGCTTCTGGGCATATTTCTCTATCCCTGAAATGATCCAAG
CAGGCGAGCTTCCTATGAAAGCCTACGATGAAGACACGGATCGTCTGATA
ACAAAAGTTCCAGGCATGGAAACTTTTCTGAGATTCCGAGATCTCCCCAG
CTTTTGCCGAGTGAGTGACGTAACCGACCGAGATTTGCAAGTTCTTAAGA
ACGCGACCCAACAGTCCCCTCGAGCCCATGCTTTGATACTCAACACGTTT
GAAGACCTAGAAGAACCAATTCTGTCACATATACGCACCAATGNCCCAAA
GTGTACACAATAGGACCTCTTCACTTGCAGCTCAAGACAGGATTCGCCTC
AACATGATCTCATCGNCATTTCAAAGTCTCCAACAGTCTNTGGGAAGNGG
ACAGAAGTTGCATTGAATGGCTTGGTAAAAGCCTGGGCGGGCTGTACTGT
ACGTAAGCTTTGGTAGCATTACACTGTTGAAAANAGANCAGCTGATTGAG
TTTTGGCACGGTCTTGTAGACAGTAAGCAGCGGTTCTTGTGGGTCATTAG
GCCAGATTCTGTGATTGGCGAAGGTGACGCCCTGGCAGAGCTTGTGGAGG
GCACGAAGGAGAGAGGTCTTTTGGTTAGTTGGGTTCCACAGGAGGAGGTA
CTGGCTCACCAGGCTGTGGCTGGATTCTTGACACACAGCGGCTGGAACTC
AACCTTGGAGAGTATAGTAGCCGGGGTGCCAATGATTTGCTGGCCTTACT
TTGCTGATCAACAGATCAATAGTAGGTTTGTGAGTGAAGTGTGGAATCTT
GGATTGGATATGAAGGATGTGTGCGATAGAAATGTTGTTGAGAAAATGGT
GAATGATCTGATGGTGGAGAGGAAGGAGGAGTTTATGAGAGCAGCTGATC
GGATGGCTACAATGGCTAGAACCACTGCTAATGAAGGTGGACCATCTTAC
TGTAATTTGGACCGTCTGATTGATGATATTAAGATGATGAGCTCCCAAGC
ATGAAAACATATAGCTAAGGTTAGTGCAAGATGTTACTGCTAGATTAAAT
AAATTTTAAAGTTTAGAGATTCTTATCAATAAAAATTAATGTTATATGTA
CATCTGTCTTGATGACTGCTAGTACGCTACTACTAGATTATCTATTGGGA
ATGGCTGCGCTTGGCATTTTGTTAAAAAGTCAT
back to top