DC900315

Overview
NameDC900315
Unique NameDC900315
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length569
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig8073 contig Csv1_Contig8073:1309..1877. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: UPL1_ARATH (E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3)

HSP 1 Score: 286.574 bits (732), Expect = 5.905e-77
Identity = 140/177 (79.10%), Postives = 156/177 (88.14%), Query Frame = 2
Query:   26 KTSGHGTKVDEKQIAFVRFSEKHRKLLNAFIRQNPGLLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQHDHHHS-PLRISVRRAYILEDSYNQLRMRSTQDLKGRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKAL 553
            KTS    K  +  + F +F+EKHR+LLN+FIRQNP LLEKS S+MLK PR +DFDNK+A+FRS+I+HQHD H S PLRISVRRAY+LEDSYNQLRMRS QDLKGRL V FQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGN++TFQPNPNSVYQTEHLSYFKFVGR+V KAL
Sbjct: 3243 KTSVDSQKKTDGSVTFSKFAEKHRRLLNSFIRQNPSLLEKSLSMMLKAPRLIDFDNKKAYFRSRIRHQHDQHISGPLRISVRRAYVLEDSYNQLRMRSPQDLKGRLNVQFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNDATFQPNPNSVYQTEHLSYFKFVGRMVAKAL 3419          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: UPL2_ARATH (E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=2)

HSP 1 Score: 284.263 bits (726), Expect = 2.931e-76
Identity = 139/177 (78.53%), Postives = 155/177 (87.57%), Query Frame = 2
Query:   26 KTSGHGTKVDEKQIAFVRFSEKHRKLLNAFIRQNPGLLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQHDHHHS-PLRISVRRAYILEDSYNQLRMRSTQDLKGRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKAL 553
            KT     K  +  + F +F EKHR+LLN+F+RQNP LLEKSFS+MLK PR +DFDNK+A+FRS+I+HQHD H S PLRISVRRAY+LEDSYNQLRMRS QDLKGRL V FQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGN++TFQPNPNSVYQTEHLSYFKFVGR+V KAL
Sbjct: 3220 KTIVDSQKKIDGSVTFSKFVEKHRRLLNSFVRQNPSLLEKSFSMMLKAPRLIDFDNKKAYFRSRIRHQHDQHISGPLRISVRRAYVLEDSYNQLRMRSPQDLKGRLNVQFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNDATFQPNPNSVYQTEHLSYFKFVGRMVAKAL 3396          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: TOM1_NEUCR (E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa GN=B11B22.010 PE=3 SV=3)

HSP 1 Score: 159.844 bits (403), Expect = 8.336e-39
Identity = 75/166 (45.18%), Postives = 113/166 (68.07%), Query Frame = 2
Query:   71 FVRFSEKHRKLLNAFIRQNPGLLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQHD---HHHSPLRISVRRAYILEDSYNQLRMRSTQDLK-GRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNE-STFQPNPNSVYQTEHLSYFKFVGRVVGKAL 553
            F  F+E+HR++LN  +R NP L+  +FSL++K P+ ++FDNKR +F   +  ++    H   PL++ VRR ++  DS+  L  +   +LK G+L + FQGEEG+DAGG+TREW+Q+LSR +FD   +LF  V ++ +TF PN  S    EHL +FKF+GR++GKAL
Sbjct: 3606 FFTFTEEHRRILNELVRHNPKLMSGTFSLLVKNPKVLEFDNKRNYFNRSVHSKYQQTRHSFPPLQLQVRREHVFHDSFRSLYYKKADELKFGKLNIRFQGEEGVDAGGVTREWFQVLSRQMFDPNYVLFVPVSSDRTTFHPNKLSPINDEHLPFFKFIGRIIGKAL 3771          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: TOM1_ASHGO (Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii GN=TOM1 PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.502e-37
Identity = 77/167 (46.11%), Postives = 112/167 (67.07%), Query Frame = 2
Query:   71 FVRFSEKHRKLLNAFIRQNPGLLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQHDHHHSPLRISVRRAYILEDSYNQLRMRSTQDLK-GRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNE-STFQPNPNSVYQTEHLSYFKFVGRVVGKALCAVC 565
            F  F++ H+KLLN  IR NP L+   FSL++K P+ +DFDNKR +F ++++    H    L ISVRR ++  DSY  L  +S +D+K  +L + F+GE G+DAGG+TREWYQ+LSR +F+    LF  V ++ +TF+PN  S    EHLS+FKF+G ++GKA+   C
Sbjct: 2842 FFAFTDLHKKLLNEMIRSNPKLMSGPFSLLVKNPKILDFDNKRYYFTAQLR-AITHDRPKLSISVRREHVFLDSYRSLFFKSNEDIKISKLEISFKGEAGVDAGGITREWYQVLSRQMFNPDYALFIPVASDKTTFRPNRTSGINPEHLSFFKFIGMIIGKAISDQC 3007          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: PTR1_SCHPO (E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe GN=ptr1 PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 5.591e-35
Identity = 70/164 (42.68%), Postives = 110/164 (67.07%), Query Frame = 2
Query:   71 FVRFSEKHRKLLNAFIRQNPGLLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQ-HDHHHSPLRISVRRAYILEDSYNQLRMRSTQDLK-GRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTV-GNESTFQPNPNSVYQTEHLSYFKFVGRVVGKAL 553
            F+ F+E+HRK++N  +   P L+  SFSL++K P+ ++F+NKR +F  ++  +     + PL I+VRR ++  DSY  L  +   ++K  +L +HF+ EEG+DAGG+TREW Q+L+R +F+    LF  V G+ +TF PN +S    +HLS+FKF GR++GKAL
Sbjct: 2809 FISFTEEHRKIINMMVFTTPSLMSGSFSLLVKNPKVLEFENKRNYFNRQLHEEAAKEQYPPLNITVRRDHVFLDSYRALHFKDADEVKFSKLNIHFRDEEGVDAGGVTREWLQVLARQMFNPDYALFLPVTGDATTFHPNRDSSVNPDHLSFFKFTGRIIGKAL 2972          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: TOM1_YEAST (E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae GN=TOM1 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.246e-34
Identity = 76/168 (45.24%), Postives = 110/168 (65.48%), Query Frame = 2
Query:   71 FVRFSEKHRKLLNAFIRQNPGLLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQHDHHHSP-LRISVRRAYILEDSYNQLRMRSTQDLK-GRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTV-GNESTFQPNPNSVYQTEHLSYFKFVGRVVGKALCAVC 565
            F  F++ H+KLLN  IR NP L+   F+L++K P+ +DFDNKR  F +K+K   D+   P L I+VRR  +  DSY  L  ++  ++K  +L + F+GE G+DAGG+TREWYQ+LSR +F+    LF  V  +++TF PN  S    EHLS+FKF+G ++GKA+   C
Sbjct: 2852 FFPFTDAHKKLLNQMIRSNPKLMSGPFALLVKNPKVLDFDNKRYFFNAKLK--SDNQERPKLPITVRREQVFLDSYRALFFKTNDEIKNSKLEITFKGESGVDAGGVTREWYQVLSRQMFNPDYALFLPVPSDKTTFHPNRTSGINPEHLSFFKFIGMIIGKAIRDQC 3017          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: HUWE1_MOUSE (E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus GN=Huwe1 PE=1 SV=4)

HSP 1 Score: 134.42 bits (337), Expect = 3.750e-31
Identity = 70/164 (42.68%), Postives = 107/164 (65.24%), Query Frame = 2
Query:   71 FVRFSEKHRKLLNAFIRQNPG-LLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQHDH-HHSPLRISVRRAYILEDSYNQLRMRSTQDLKGRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLF-TTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKAL 553
            F+RF+E HR +LN  +RQ+   L +  F++++   R +DFD KR +FR +++   +      + + VRR ++ EDSY +L  +S +++K RL + F+GEEG DAGGL REWY ++SR +F+    LF T+ G+  T+  NP+S     HLSYFKFVGR+V KA+
Sbjct: 3958 FLRFAETHRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAV 4121          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: HUWE1_HUMAN (E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens GN=HUWE1 PE=1 SV=3)

HSP 1 Score: 134.42 bits (337), Expect = 3.750e-31
Identity = 70/164 (42.68%), Postives = 107/164 (65.24%), Query Frame = 2
Query:   71 FVRFSEKHRKLLNAFIRQNPG-LLEKSFSLMLKVPRFVDFDNKRAHFRSKIKHQHDH-HHSPLRISVRRAYILEDSYNQLRMRSTQDLKGRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLF-TTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKAL 553
            F+RF+E HR +LN  +RQ+   L +  F++++   R +DFD KR +FR +++   +      + + VRR ++ EDSY +L  +S +++K RL + F+GEEG DAGGL REWY ++SR +F+    LF T+ G+  T+  NP+S     HLSYFKFVGR+V KA+
Sbjct: 3955 FLRFAETHRTVLNQILRQSTTHLADGPFAVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAV 4118          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: PUB1_SCHPO (E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe GN=pub1 PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 2.521e-19
Identity = 62/139 (44.60%), Postives = 84/139 (60.43%), Query Frame = 2
Query:  152 SLMLKVPRFV-DFDNKRAHFRSKIKHQHDHHHSP--LRISVRRAYILEDSYNQLRMRSTQDLKGRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLF--TTVGNESTFQPNPNSVYQTEHLSYFKFVGRVVGKAL 553
            SL   VP++  DF  K  +F S    Q   H  P    I VRR +I EDSY ++  +S  DLK RL + F GE+G+D GGL+RE++ LLS  +F+    LF  ++V N  T Q NP+S    EHL+YFKF+GRV+G A+
Sbjct:  381 SLDQNVPQYKRDFRRKLIYFLS----QPALHPLPGQCHIKVRRNHIFEDSYAEIMRQSATDLKKRLMIKFDGEDGLDYGGLSREYFFLLSHEMFNPFYCLFEYSSVDN-YTLQINPHSGINPEHLNYFKFIGRVIGLAI 514          
BLAST of DC900315 vs. ExPASy Swiss-Prot
Match: NEDD4_HUMAN (E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens GN=NEDD4 PE=1 SV=3)

HSP 1 Score: 95.1301 bits (235), Expect = 2.521e-19
Identity = 55/132 (41.67%), Postives = 81/132 (61.36%), Query Frame = 2
Query:  167 VPRFVDFDNKRAHFRSKIKHQHDHHHSPLRISVRRAYILEDSYNQLR-MRSTQDLKGRLTVHFQGEEGIDAGGLTREWYQLLSRVIFDKGALLFTTVGNES-TFQPNPNS-VYQTEHLSYFKFVGRVVGKAL 553
            VP   D+  K   FR K+K Q+D  +    + +RRA +LEDSY ++  ++    LK RL + F GE+G+D GG+ REW+ L+S+ +F+    LF     ++ T Q NPNS +   +HLSYFKF+GRV G A+
Sbjct:  935 VPYSRDYKRKYEFFRRKLKKQNDIPNK-FEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAV 1065          
The following BLAST results are available for this feature:
BLAST of DC900315 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 50
Match NameE-valueIdentityDescription
UPL1_ARATH5.905e-7779.10E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis th... [more]
UPL2_ARATH2.931e-7678.53E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis th... [more]
TOM1_NEUCR8.336e-3945.18E3 ubiquitin-protein ligase TOM1-like OS=Neurospor... [more]
TOM1_ASHGO3.502e-3746.11Probable E3 ubiquitin-protein ligase TOM1 OS=Ashby... [more]
PTR1_SCHPO5.591e-3542.68E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharo... [more]
TOM1_YEAST1.246e-3445.24E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces ... [more]
HUWE1_MOUSE3.750e-3142.68E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus ... [more]
HUWE1_HUMAN3.750e-3142.68E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens ... [more]
PUB1_SCHPO2.521e-1944.60E3 ubiquitin-protein ligase pub1 OS=Schizosaccharo... [more]
NEDD4_HUMAN2.521e-1941.67E3 ubiquitin-protein ligase NEDD4 OS=Homo sapiens ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900315 VSS Citrus sinensis cDNA clone VS28665 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900315 ID=DC900315|Name=DC900315|organism=Citrus sinensis|type=EST|length=569bp
CTCGTGCCGAATTCGGCACGAGCAGAAAACCTCAGGGCATGGTACAAAAG
TTGATGAAAAACAGATTGCTTTTGTGAGGTTCTCAGAAAAGCACAGGAAG
CTGCTAAATGCTTTCATCCGTCAAAATCCTGGATTACTAGAGAAGTCTTT
CTCACTCATGCTGAAGGTTCCTCGCTTTGTTGATTTTGACAATAAGCGTG
CACATTTCAGATCAAAAATAAAGCATCAACATGATCACCACCACAGTCCT
TTGAGAATATCTGTAAGAAGAGCTTACATTCTTGAAGATTCATACAACCA
ACTGCGCATGCGATCAACGCAAGATTTGAAGGGAAGGTTGACTGTTCACT
TTCAAGGAGAGGAAGGCATTGATGCCGGTGGCCTTACAAGGGAGTGGTAC
CAATTGCTGTCAAGGGTTATTTTTGACAAGGGAGCCCTACTTTTCACAAC
AGTGGGCAATGAATCAACATTCCAACCCAACCCCAACTCTGTTTACCAAA
CTGAACATCTTTCATATTTCAAGTTTGTTGGGCGAGTTGTTGGAAAAGCT
CTTTGTGCCGTGTGCATTC
back to top