DC900313

Overview
NameDC900313
Unique NameDC900313
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length1041
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5520 contig Csv1_Contig5520:36..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH62_CUCMA (Chaperonin CPN60-2, mitochondrial OS=Cucurbita maxima GN=CPN60-2 PE=1 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 5.252e-107
Identity = 206/243 (84.77%), Postives = 213/243 (87.65%), Query Frame = 2
Query:    5 DLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            DLAVLTGG LITEELGM+LEKV+LDMLG+CKK+TISKDDTVILDGAGDKKSIEERCEQIRSAIE STSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGV            STANFDQKIGVQIIQNALKTPVHTI             KLLEQDN DLGYDAAKGEYVDM+K+GIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPK+ KE P
Sbjct:  322 DLAVLTGGQLITEELGMNLEKVDLDMLGSCKKITISKDDTVILDGAGDKKSIEERCEQIRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLSTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYVDMIKAGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKDEKEVP 564          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH61_CUCMA (Chaperonin CPN60-1, mitochondrial OS=Cucurbita maxima GN=CPN60-1 PE=1 SV=1)

HSP 1 Score: 377.867 bits (969), Expect = 5.435e-104
Identity = 199/244 (81.56%), Postives = 210/244 (86.07%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QDLAVLTGG +ITEELGM+LEKV+LDMLG+CKK+TISKDDTVILDGAGDKK+IEERC+QIRS IE STSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGV             TANFDQKIGVQIIQNALKTPVHTI             KLLEQD+ DLGYDAAKGEYVDMVK+GIIDPLKVIRTALVDAASVSSLMTTTE +VVELPK+  E P
Sbjct:  321 QDLAVLTGGQVITEELGMNLEKVDLDMLGSCKKITISKDDTVILDGAGDKKAIEERCDQIRSGIEASTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLPTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQDDPDLGYDAAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTEVVVVELPKDENEVP 564          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH61_MAIZE (Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=CPN60I PE=1 SV=2)

HSP 1 Score: 376.326 bits (965), Expect = 1.581e-103
Identity = 199/244 (81.56%), Postives = 209/244 (85.66%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QDLA+LTGG++ITEELGM+LE     MLGTCKKVT+SKDDTVILDGAGDKKSIEER EQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGV             TANFDQKIGVQIIQNALKTPVHTI             KLLEQ+NTDLGYDAAKGEYVDMVK+GIIDPLKVIRTALVDAASVSSLMTTTE+I+VE+PKE   AP
Sbjct:  323 QDLAILTGGEVITEELGMNLENFEPHMLGTCKKVTVSKDDTVILDGAGDKKSIEERAEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQENTDLGYDAAKGEYVDMVKTGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAP 566          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60A_ARATH (Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana GN=CPN60 PE=1 SV=2)

HSP 1 Score: 372.474 bits (955), Expect = 2.283e-102
Identity = 196/243 (80.66%), Postives = 210/243 (86.42%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEA 730
            QDLA LTGG++IT+ELGM+LEKV+L MLGTCKKVT+SKDDTVILDGAGDKK IEERCEQIRSAIE STSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGI+PGGGV             TANFDQKIGVQIIQNALKTPV+TI             KLLEQDN DLGYDAAKGEYVDMVK+GIIDPLKVIRTALVDAASVSSL+TTTEA+VV+LPK+  E+
Sbjct:  320 QDLAALTGGEVITDELGMNLEKVDLSMLGTCKKVTVSKDDTVILDGAGDKKGIEERCEQIRSAIELSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGILPGGGVALLYAARELEKLPTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLEQDNPDLGYDAAKGEYVDMVKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVVDLPKDESES 562          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH62_MAIZE (Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=CPN60II PE=2 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 5.087e-102
Identity = 196/244 (80.33%), Postives = 208/244 (85.25%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QDLA+LTGG++ITEELGM+LE V   MLG+CKKVT+SKDDTVILDGAGDKKSIEER +QIRSA+ENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGV             TANFDQKIGVQIIQNALKTPVHTI             KLLEQ NTDLGYDAAK EYVDMVK+GIIDPLKVIRTALVDAASVSSLMTTTE+I+VE+PKE   AP
Sbjct:  323 QDLAILTGGEVITEELGMNLENVEPHMLGSCKKVTVSKDDTVILDGAGDKKSIEERADQIRSAVENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLQTANFDQKIGVQIIQNALKTPVHTIASNAGVEGAVVVGKLLEQGNTDLGYDAAKDEYVDMVKAGIIDPLKVIRTALVDAASVSSLMTTTESIIVEIPKEEAPAP 566          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60B_ARATH (Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g33210 PE=1 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 1.214e-95
Identity = 182/243 (74.90%), Postives = 200/243 (82.30%), Query Frame = 2
Query:    5 DLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            DLA LTG  +ITEELGM+L+ ++L M G CKKVT+SKDDTV+LDGAGDK++I ERCEQIRS +E STSDYDKEKLQERLAKLSGGVAVLKIGGASE EV EKKDRVTDALNATKAAVEEGIVPGGGV            STANFDQKIGVQIIQNALKTPV+TI             KLLEQDN DLGYDAAKGEYVDM+K+GIIDPLKVIRTALVDAASVSSL+TTTEA+V E+P +   +P
Sbjct:  322 DLAALTGAQVITEELGMNLDNIDLSMFGNCKKVTVSKDDTVVLDGAGDKQAIGERCEQIRSMVEASTSDYDKEKLQERLAKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELEKLSTANFDQKIGVQIIQNALKTPVYTIASNAGVEGAVVVGKLLEQDNPDLGYDAAKGEYVDMIKAGIIDPLKVIRTALVDAASVSSLLTTTEAVVTEIPTKEVASP 564          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60_BRANA (Chaperonin CPN60, mitochondrial OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 5.099e-94
Identity = 183/244 (75.00%), Postives = 199/244 (81.56%), Query Frame = 2
Query:    5 DLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILD-GAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            DLA LTG  +ITEELGM+LEK++L MLG CKK+T+SKDDTV L  GAGDKK+I ERCEQIRS +E S SDYDKEKLQERLAKLSGGVAVLKIGGASE+EVGEKKDRVTDALNATKAAVEEGIVPGGGV            STANFD KIGVQIIQNALKTPV+TI             KLLE DN DLGYDAAKGEYVDMVKSGIIDP+KVIRTALVDAASVSSL+TTTEA+V E+P +   +P
Sbjct:  324 DLATLTGAQVITEELGMNLEKIDLSMLGNCKKITVSKDDTVFLGWGAGDKKAIGERCEQIRSMVEASESDYDKEKLQERLAKLSGGVAVLKIGGASESEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYASKELDKLSTANFDHKIGVQIIQNALKTPVYTIASNAGVEGAVIVGKLLESDNPDLGYDAAKGEYVDMVKSGIIDPVKVIRTALVDAASVSSLLTTTEAVVTEIPTKEDASP 567          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH60C_ARATH (Chaperonin CPN60-like 2, mitochondrial OS=Arabidopsis thaliana GN=At3g13860 PE=1 SV=2)

HSP 1 Score: 293.508 bits (750), Expect = 1.348e-78
Identity = 151/233 (64.81%), Postives = 182/233 (78.11%), Query Frame = 2
Query:    5 DLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVV 703
            DLAVLTG ++I+EE G+ LEK+  ++LGT KKVT+++DDT+IL G GDKK IEERCE++RSA E STS +D+EK QERL+KLSGGVAV K+GGASE+EVGE+KDRVTDALNAT+AAVEEGI+PGGGV             T N DQ+ GVQI+QNALK P  TI             KLLEQD+ + G+DAAKG+YVDMVK+GIIDP+KVIRTAL DAASVS L+TTTEA V+
Sbjct:  321 DLAVLTGAEVISEERGLSLEKIRPELLGTAKKVTVTRDDTIILHGGGDKKLIEERCEELRSANEKSTSTFDQEKTQERLSKLSGGVAVFKVGGASESEVGERKDRVTDALNATRAAVEEGIIPGGGVALLYATKALDNLQTENEDQRRGVQIVQNALKAPAFTIAANAGYDGSLVVGKLLEQDDCNFGFDAAKGKYVDMVKAGIIDPVKVIRTALTDAASVSLLLTTTEASVL 553          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH601_RHORT (60 kDa chaperonin 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / NCIB 8255) GN=groL1 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.222e-71
Identity = 138/244 (56.56%), Postives = 178/244 (72.95%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            +D+A+LTGG +I+E+LG+ LE V LDMLGT K VTI+KD+T I+DGAG K  I+ RC QIR+ IE++TSDYD+EKLQERLAKLSGGVAV+++GGASE EV EKKDRV DA++AT+AAVEEGI+ GGGV            S AN DQK+G++I++ AL+ PV  I             KLLE  + D GY+A  G Y ++VK G+IDP KV+RTAL  AASV+SL+ TTEA+V E+P++    P
Sbjct:  290 EDIAILTGGQVISEDLGIKLETVTLDMLGTAKTVTITKDNTTIVDGAGVKADIDARCAQIRATIEDTTSDYDREKLQERLAKLSGGVAVIRVGGASEVEVKEKKDRVDDAMHATRAAVEEGIIAGGGVALLHAAKALDALSPANADQKVGIEIVRRALQAPVRQIAENAGVDGAVVAGKLLESSDADFGYNAQTGVYENLVKVGVIDPTKVVRTALQGAASVASLLITTEAMVAEIPEKKPALP 533          
BLAST of DC900313 vs. ExPASy Swiss-Prot
Match: CH602_AZOC5 (60 kDa chaperonin 2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=groL2 PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 2.723e-71
Identity = 139/244 (56.97%), Postives = 173/244 (70.90%), Query Frame = 2
Query:    2 QDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVXXXXXXXXXXXXSTANFDQKIGVQIIQNALKTPVHTIXXXXXXXXXXXXXKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEXKEAP 733
            QD+A+LTGG  I+E+LG+ LE VNL MLG  KKV I K++T I+DG G+K  IE R  QI++ IE +TSDYD+EKLQERLAKL+GGVAV+++GGA+E EV EKKDRV DAL+AT+AAVEEGIVPGGGV               N DQK G+ I++ A++ P   I             K+LE +    GY+A  GEYVDMV SGIIDP KV+RTAL DAAS+S+L+ TTEA+VVELPK+   AP
Sbjct:  290 QDIAILTGGQAISEDLGIKLENVNLSMLGRAKKVVIEKENTTIVDGNGEKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEKKDRVDDALHATRAAVEEGIVPGGGVALLRAIKVLEGLKVENTDQKTGIDIVRRAIQAPARQIVANAGDDGSVVVGKILENETYTFGYNAQTGEYVDMVASGIIDPAKVVRTALQDAASISALIITTEALVVELPKKAAAAP 533          
The following BLAST results are available for this feature:
BLAST of DC900313 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH62_CUCMA5.252e-10784.77Chaperonin CPN60-2, mitochondrial OS=Cucurbita max... [more]
CH61_CUCMA5.435e-10481.56Chaperonin CPN60-1, mitochondrial OS=Cucurbita max... [more]
CH61_MAIZE1.581e-10381.56Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=C... [more]
CH60A_ARATH2.283e-10280.66Chaperonin CPN60, mitochondrial OS=Arabidopsis tha... [more]
CH62_MAIZE5.087e-10280.33Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=C... [more]
CH60B_ARATH1.214e-9574.90Chaperonin CPN60-like 1, mitochondrial OS=Arabidop... [more]
CH60_BRANA5.099e-9475.00Chaperonin CPN60, mitochondrial OS=Brassica napus ... [more]
CH60C_ARATH1.348e-7864.81Chaperonin CPN60-like 2, mitochondrial OS=Arabidop... [more]
CH601_RHORT1.222e-7156.5660 kDa chaperonin 1 OS=Rhodospirillum rubrum (stra... [more]
CH602_AZOC52.723e-7156.9760 kDa chaperonin 2 OS=Azorhizobium caulinodans (s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900313 VSS Citrus sinensis cDNA clone VS28663 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900313 ID=DC900313|Name=DC900313|organism=Citrus sinensis|type=EST|length=1041bp
GCAGGATCTGGCTGTTCTCACTGGTGGTGATCTGATAACTGAAGAGCTCG
GCATGGACCTTGAGAAAGTGAATCTGGATATGCTCGGCACTTGCAAAAAG
GTTACAATATCGAAGGATGACACTGTCATTCTGGACGGTGCTGGTGATAA
GAAGTCCATTGAAGAAAGATGTGAACAGATTAGGTCTGCGATTGAGAACA
GCACTTCTGATTATGACAAGGAGAAGTTGCAAGAAAGATTGGCAAAGCTT
TCTGGTGGTGTTGCTGTGTTGAAGATTGGAGGAGCTAGTGAAGCTGAAGT
TGGTGAGAAGAAAGATAGAGTTACTGATGCTTTGAATGCGACAAAGGCAG
CTGTAGAAGAGGGTATTGTGCCGGGTGGTGGTGTTGCCCTTCTATATGCG
GCAAAAGAGTTGGAAAAGCTGTCCACTGCTAACTTTGACCAGAAGATTGG
TGTTCAGATTATTCAGAATGCTCTAAAGACACCAGTGCACACAATTGCTG
CTAATGCAGGAGTTGAGGGGGCTGTTGTGGTTGGTAAGCTATTGGAGCAG
GACAACACTGACCTTGGGTATGATGCCGCCAAAGGTGAGTATGTTGATAT
GGTCAAATCTGGAATTATCGATCCATTGAAAGTAATCAGAACTGCTTTGG
TTGATGCTGCAAGTGTATCATCTTTAATGACCACAACTGAAGCTATTGTT
GTTGAGCTGCCTAAGGAGGANAAGGAAGCTCCGGGAGGCATGGGTGGCAT
GGGCGGAATGGGCGGCATGGACTATTGAAATCCCAGTANAATGCTTAACT
GATTGTCCCTTTTTTTTTTTTTTGGGGTTCCATAATCAACATACAATCTG
AATGTTAGGATTTTGTGGCCAGCTTAATNANAAAAAANTGTGTCAATCAT
AAGGCATCCTTGTAATCATAGTGANAGGTAGGCATTTAGGTCGTTTGGCA
ATTTAGGATAAAACATTGCTGATTTAGGTCGTTTGGCAATCCNCTTGGAT
GATTGGTTGGTTTTTAATTGAACTGGATTTTNTTTCCCATT
back to top