DC900310

Overview
NameDC900310
Unique NameDC900310
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length760
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1060 contig Csv1_Contig1060:206..963. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900310 vs. ExPASy Swiss-Prot
Match: ZN622_MOUSE (Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.515e-15
Identity = 61/207 (29.47%), Postives = 95/207 (45.89%), Query Frame = 2
Query:   83 TSVMGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHXXXXXXXXXXXXXXXXXXSSSYMDEDGKQLISSSDMANTVELGGGS-ELIITKRTDKGTSTKTFGSREYLRYYRQK---PRP-SPANNVAITAALASRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNL 688
            T V  FFIPD+EYL D KGL+ YLG KV    +CL+CN++   F S EAV+ HM  K HCK+                      Y +      + +      +E    + ELI+        S    G R  +RYY+Q+   PR  + A N      +  +Y+++G     T   ++R + ++ + R   + M  ++GMKNN  + +
Sbjct:  271 TKVHSFFIPDIEYLSDLKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDYKEGQDPAELEALSTDKILECDDETMELIL-------PSGARVGHRSLMRYYKQRFGLPRAVTVARNQKAVGRVLQQYRALGWMG-STGAALMRERDMQYVQRMKSKWM-LKIGMKNNATKQM 468          
BLAST of DC900310 vs. ExPASy Swiss-Prot
Match: ZN622_HUMAN (Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.230e-13
Identity = 62/205 (30.24%), Postives = 97/205 (47.32%), Query Frame = 2
Query:   98 FFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKIHXXXXXXXXXXXXXXXXXXSSSYMD-EDGKQLISSSDMANTVEL---GGGSELIITKRTDKGTSTKTFGSREYLRYYRQK----PRPSPANNVAITAALASRYKSMGLATVQTREHMVRMKVIKEMNRTGVEAMRTRVGMKNNIIRNL 688
            FFIPD+EYL D KGL+ YLG KV    +CL+CN++   F S EAV+ HM  K HCK+                    SSY D ++G+    + ++ +   L       ELI+        S    G R  +RYY+Q+       + A N      +  +Y+++G  T  T   ++R + ++ + R   + M  + GMKNN  + +
Sbjct:  277 FFIPDIEYLSDIKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKL---FTDGDAALEFADFYDFRSSYPDHKEGEDPNKAEELPSEKNLEYDDETMELIL-------PSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVGRVLQQYRALGW-TGSTGAALMRERDMQYVQRMKSKWM-LKTGMKNNATKQM 469          
BLAST of DC900310 vs. ExPASy Swiss-Prot
Match: ZN622_RAT (Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.319e-12
Identity = 34/62 (54.84%), Postives = 42/62 (67.74%), Query Frame = 2
Query:   83 TSVMGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKI 268
            T V  FFIPD+EYL D KGL+ YLG KV    +CL+CN++   F S EAV+ HM  K HCK+
Sbjct:  265 TKVHSFFIPDIEYLSDLKGLIKYLGEKVGVGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKL 326          
BLAST of DC900310 vs. ExPASy Swiss-Prot
Match: ZN622_CHICK (Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.963e-11
Identity = 31/62 (50.00%), Postives = 42/62 (67.74%), Query Frame = 2
Query:   83 TSVMGFFIPDVEYLKDPKGLLTYLGLKVKRDFMCLYCNDRCHPFNSLEAVRKHMEAKRHCKI 268
            T V  FFIPD+EYL D +GL+ YLG K+    +C++CN++   F S EAV+ HM  K HCK+
Sbjct:  264 TKVHSFFIPDIEYLVDLRGLIKYLGEKIGVGKICIWCNEKGKSFYSTEAVQAHMNDKSHCKL 325          
The following BLAST results are available for this feature:
BLAST of DC900310 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ZN622_MOUSE8.515e-1529.47Zinc finger protein 622 OS=Mus musculus GN=Znf622 ... [more]
ZN622_HUMAN1.230e-1330.24Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 ... [more]
ZN622_RAT2.319e-1254.84Zinc finger protein 622 OS=Rattus norvegicus GN=Zn... [more]
ZN622_CHICK1.963e-1150.00Zinc finger protein 622 OS=Gallus gallus GN=ZNF622... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900310 VSS Citrus sinensis cDNA clone VS28660 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900310 ID=DC900310|Name=DC900310|organism=Citrus sinensis|type=EST|length=760bp
GCCTTGAGGAGTTCGATCCAGCATGTTGCTTTCATGTGTGATCTTCCGCN
CGATGCAATTGAGAACTGCATGGTTCACATGTACAAGTGTCATGGGTTTC
TTTATTCCTGATGTTGAGTATTTGAAGGATCCAAAAGGCCTGCTTACTTA
TCTTGGTCTTAAGGTTAAGAGGGATTTCATGTGTTTATACTGCAATGATA
GGTGCCATCCTTTTAACAGCTTGGAAGCAGTTAGGAAGCATATGGAAGCA
AAACGTCATTGCAAAATACATTTCGGCGATGGTGATGACGAGGAGGAGGC
CGAGTTAGAAGAGTTCTATGACTATAGCAGCAGTTACATGGATGAGGATG
GGAAACAGCTGATCTCATCCAGTGACATGGCCAACACTGTAGAGCTTGGT
GGTGGGTCTGAGCTTATCATAACAAAGAGAACAGATAAAGGAACATCGAC
TAAAACGTTCGGCTCCCGTGAATATCTGCGGTATTATCGCCAGAAACCCC
GCCCGTCACCGGCAAATAATGTGGCCATTACAGCTGCGCTGGCCTCAAGG
TACAAGAGCATGGGATTAGCAACCGTGCAAACAAGAGAGCACATGGTGAG
GATGAAGGTAATCAAGGAGATGAATAGAACGGGAGTGGAGGCAATGCGCA
CAAGGGTCGGCATGAAGAATAATATCATCCGAAACCTCCCCAAGAATGTC
CCATATTAGTCCTAGACTTTAATTTCTTGTTGAATCAGCAGTTTAAGTAA
ACTTTTAATT
back to top