DC900309

Overview
NameDC900309
Unique NameDC900309
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length426
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900309 vs. ExPASy Swiss-Prot
Match: ZN622_CHICK (Zinc finger protein 622 OS=Gallus gallus GN=ZNF622 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.093e-12
Identity = 45/126 (35.71%), Postives = 63/126 (50.00%), Query Frame = 1
Query:   13 MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVT-EXXXXXXXXXXXXEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHI---MRASQGTSNEEK---EKVIIKPIPLRDVNK 369
            M   TC +C   F D   Q+ HYK+DWHRYNLKRKVA +P VT E             + ++    TY C +C K + +  A   HL S+ H+    +A Q  S + K   EK + K + +  V+K
Sbjct:    1 MATYTCITCRVAFKDADIQRAHYKTDWHRYNLKRKVADMPPVTAENFQERVLAQRAVAEERDKVTATY-CTVCSKRFSTFNAYENHLKSKKHLELEKKAVQAVSKKVKILNEKNLEKGLAVESVDK 125          
BLAST of DC900309 vs. ExPASy Swiss-Prot
Match: ZN622_RAT (Zinc finger protein 622 OS=Rattus norvegicus GN=Znf622 PE=2 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 1.208e-11
Identity = 41/125 (32.80%), Postives = 58/125 (46.40%), Query Frame = 1
Query:   13 MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEXXXXXXXXXXXXEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHI---MRASQGTSNEEK---EKVIIKPIPLRDVNK 369
            M   TC +C   F D   Q+ HYK+DWHRYNL+RKVA +  VT                + +      C +C K + +  A   HL SR H+    +A Q  S + +   EK + K + +  VNK
Sbjct:    1 MATYTCITCRVAFRDAEMQRAHYKTDWHRYNLRRKVANMAPVTAEGFQERVRAQRAVAEEESKGTATYCTVCSKKFATFNAYENHLKSRRHVELEKKAVQAVSRQVEMMNEKNLEKGLGVDSVNK 125          
BLAST of DC900309 vs. ExPASy Swiss-Prot
Match: ZN622_MOUSE (Zinc finger protein 622 OS=Mus musculus GN=Znf622 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.578e-11
Identity = 40/96 (41.67%), Postives = 48/96 (50.00%), Query Frame = 1
Query:   13 MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVT-----EXXXXXXXXXXXXEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSH 285
            M  LTC +C   F D   Q+ HYK+DWHRYNL+RKVA +  VT     E            E +K A   TY C  CGK + +  A   HL SR H
Sbjct:    1 MAALTCITCRVAFRDAELQRAHYKTDWHRYNLRRKVAAMAPVTAEGFQERVRAQRAVAEAAEASKGAA--TY-CTACGKKFATFNAYENHLGSRRH 93          
BLAST of DC900309 vs. ExPASy Swiss-Prot
Match: ZN622_HUMAN (Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 5.996e-11
Identity = 33/92 (35.87%), Postives = 43/92 (46.74%), Query Frame = 1
Query:   13 MPGLTCNSCNREFNDDAEQKLHYKSDWHRYNLKRKVAGVPGVTEXXXXXXXXXXXXEKNKNATPMTYSCGLCGKGYRSSKALAQHLNSRSHI 288
            M   TC +C   F D   Q+ HYK+DWHRYNL+RKVA +  VT                + +      C +C K + S  A   HL SR H+
Sbjct:    1 MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKGSATYCTVCSKKFASFNAYENHLKSRRHV 92          
The following BLAST results are available for this feature:
BLAST of DC900309 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ZN622_CHICK1.093e-1235.71Zinc finger protein 622 OS=Gallus gallus GN=ZNF622... [more]
ZN622_RAT1.208e-1132.80Zinc finger protein 622 OS=Rattus norvegicus GN=Zn... [more]
ZN622_MOUSE1.578e-1141.67Zinc finger protein 622 OS=Mus musculus GN=Znf622 ... [more]
ZN622_HUMAN5.996e-1135.87Zinc finger protein 622 OS=Homo sapiens GN=ZNF622 ... [more]
back to top
Properties
Property NameValue
Genbank descriptionDC900309 VSS Citrus sinensis cDNA clone VS28660 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900309 ID=DC900309|Name=DC900309|organism=Citrus sinensis|type=EST|length=426bp
AAAGAACACAACATGCCGGGGCTGACCTGCAATTCATGTAACAGAGAATT
CAATGACGACGCCGAGCAGAAGCTTCACTACAAGTCCGATTGGCACCGCT
ACAATCTCAAACGCAAGGTGGCCGGGGTTCCAGGAGTGACAGAAGCTCTA
TTTCTGGCTAGACAAGCGGCACTTGCTCAAGAGAAAAATAAGAATGCGAC
CCCAATGACCTACAGTTGTGGTCTTTGTGGAAAAGGGTACAGAAGCTCTA
AGGCTCTTGCTCAGCATCTCAACTCACGAAGCCACATTATGCGGGCTTCT
CAAGGAACGAGTAATGAAGAGAAGGAGAAGGTAATAATTAAGCCAATTCC
GCTTCGTGATGTAAATAAGCCTCCTCGGAAAAGAGAAGCAAACAATGAAG
AAAGTGAAGATAGTGATGATGAGTGG
back to top