DC900308

Overview
NameDC900308
Unique NameDC900308
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length662
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:1050..1711. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK1_SOLTU (S-adenosylmethionine synthetase 1 OS=Solanum tuberosum GN=METK1 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 5.508e-54
Identity = 100/104 (96.15%), Postives = 104/104 (100.00%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 374
            AAKSIVA+GLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGMM+INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ
Sbjct:  289 AAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMSINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQ 392          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK_MEDTR (S-adenosylmethionine synthetase OS=Medicago truncatula GN=METK PE=3 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 7.194e-54
Identity = 100/105 (95.24%), Postives = 104/105 (99.05%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPD+EIL+IVKE+FDFRPGM+TINLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  290 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDREILQIVKENFDFRPGMITINLDLKRGGNSRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 394          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK2_ELAUM (S-adenosylmethionine synthetase 2 OS=Elaeagnus umbellata GN=SAMS2 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 9.396e-54
Identity = 99/105 (94.29%), Postives = 104/105 (99.05%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKSIVANGLARRCIVQVSYAIGVP+PLSVFVDSYGTGKIPDKEILKIVKE+FDFRPGM+TINLDLKRGGN RFLKTAAYGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  289 AAKSIVANGLARRCIVQVSYAIGVPDPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMITINLDLKRGGNDRFLKTAAYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 2.093e-53
Identity = 102/105 (97.14%), Postives = 104/105 (99.05%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPDKEILKIVKE+FDFRPGMMTINLDLKRGGN RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA
Sbjct:  289 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMMTINLDLKRGGN-RFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 392          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK2_VITVI (S-adenosylmethionine synthetase 2 OS=Vitis vinifera GN=METK2 PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.734e-53
Identity = 99/105 (94.29%), Postives = 104/105 (99.05%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVD+YGTGKIPD+EILKIVKE+FDFRPGM++INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK QA
Sbjct:  289 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDREILKIVKENFDFRPGMISINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKTQA 393          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK1_ELAUM (S-adenosylmethionine synthetase 1 OS=Elaeagnus umbellata GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 3.570e-53
Identity = 97/105 (92.38%), Postives = 103/105 (98.10%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKSIVANGLARRC+VQVSYAIGVPEPLSVFVDSYGTG+IPDKEIL IVKE+FDFRPGM+TINLDLKRGGNGRFLKTA YGHFGRDDPDFTWE+VKPLKWEKPQ+
Sbjct:  289 AAKSIVANGLARRCLVQVSYAIGVPEPLSVFVDSYGTGQIPDKEILNIVKENFDFRPGMITINLDLKRGGNGRFLKTAGYGHFGRDDPDFTWEIVKPLKWEKPQS 393          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK_BRARP (S-adenosylmethionine synthetase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.663e-53
Identity = 98/105 (93.33%), Postives = 103/105 (98.10%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  289 AAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK5_BRAJU (S-adenosylmethionine synthetase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.663e-53
Identity = 98/105 (93.33%), Postives = 103/105 (98.10%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  289 AAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK3_BRAJU (S-adenosylmethionine synthetase 3 OS=Brassica juncea GN=MSAMS3 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.663e-53
Identity = 98/105 (93.33%), Postives = 103/105 (98.10%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEKPQA 377
            AAKS+VANG+ARR +VQVSYAIGVPEPLSVFVD+YGTG IPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKW+KPQA
Sbjct:  289 AAKSVVANGMARRALVQVSYAIGVPEPLSVFVDTYGTGLIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWDKPQA 393          
BLAST of DC900308 vs. ExPASy Swiss-Prot
Match: METK5_VITVI (S-adenosylmethionine synthetase 5 OS=Vitis vinifera GN=METK5 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.090e-53
Identity = 99/102 (97.06%), Postives = 101/102 (99.02%), Query Frame = 3
Query:   63 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMMTINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 368
            AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKE+FDFRPGM+ INLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK
Sbjct:  289 AAKSIVANGLARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKENFDFRPGMIAINLDLKRGGNGRFLKTAAYGHFGRDDPDFTWEVVKPLKWEK 390          
The following BLAST results are available for this feature:
BLAST of DC900308 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK1_SOLTU5.508e-5496.15S-adenosylmethionine synthetase 1 OS=Solanum tuber... [more]
METK_MEDTR7.194e-5495.24S-adenosylmethionine synthetase OS=Medicago trunca... [more]
METK2_ELAUM9.396e-5494.29S-adenosylmethionine synthetase 2 OS=Elaeagnus umb... [more]
METK1_POPTR2.093e-5397.14S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK2_VITVI2.734e-5394.29S-adenosylmethionine synthetase 2 OS=Vitis vinifer... [more]
METK1_ELAUM3.570e-5392.38S-adenosylmethionine synthetase 1 OS=Elaeagnus umb... [more]
METK_BRARP4.663e-5393.33S-adenosylmethionine synthetase OS=Brassica rapa s... [more]
METK5_BRAJU4.663e-5393.33S-adenosylmethionine synthetase 5 OS=Brassica junc... [more]
METK3_BRAJU4.663e-5393.33S-adenosylmethionine synthetase 3 OS=Brassica junc... [more]
METK5_VITVI6.090e-5397.06S-adenosylmethionine synthetase 5 OS=Vitis vinifer... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900308 VSS Citrus sinensis cDNA clone VS28659 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900308 ID=DC900308|Name=DC900308|organism=Citrus sinensis|type=EST|length=662bp
GCTGGAGCCATGTGCGGGCTTCTCTGAAAGACCTACTAGTGAAGAGTGTG
CATCATGTAGCAGCTGCTAAGAGCATTGTTGCAAACGGGCTTGCTCGCAG
GTGCATTGTCCAAGTCTCCTATGCCATTGGTGTGCCTGAGCCATTGTCTG
TTTTTGTGGACTCATATGGAACCGGCAAGATTCCTGACAAGGAGATCCTC
AAAATTGTGAAGGAAAGCTTTGATTTCAGGCCAGGAATGATGACCATCAA
TTTGGATCTCAAAAGGGGCGGTAATGGCAGGTTCTTGAAGACTGCTGCCT
ATGGACATTTTGGCAGGGATGACCCAGACTTCACTTGGGAAGTTGTGAAG
CCCCTCAAGTGGGAAAAGCCTCAAGCTTAAATTTGAGTTGAAAAGTGAAA
ACTATCCCTGCTGTTCAAGTTTGCTTCTATTGGTAGTGGATGAATAATTT
GAATATTATCTTGCTGCTGCTTTGTAATACTAAGCAAATCTCCTGTGTTC
AGAACTCATACATGTTCCCCATTCAATTCCTTTCTTTTTCTTCTTTCCCC
ACTTCTTTTTTGGTTTTGGTTTAATGTACCATGTCACCACTGTTGTGTAG
TGATATNGATTGAGAATTTTGCTCAACTGGTGCCTGGAATTAGTAAAATT
CTTCCTTTTGCT
back to top