DC900307

Overview
NameDC900307
Unique NameDC900307
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length635
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1234 contig Csv1_Contig1234:162..796. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK2_ARATH (S-adenosylmethionine synthetase 2 OS=Arabidopsis thaliana GN=SAM2 PE=1 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.795e-99
Identity = 172/183 (93.99%), Postives = 176/183 (96.17%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA +DYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GARLTEVRKN TC WLRPDGKTQVT EYYNDNGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATIDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGARLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK1_POPTR (S-adenosylmethionine synthetase 1 OS=Populus trichocarpa GN=METK1 PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.795e-99
Identity = 171/183 (93.44%), Postives = 177/183 (96.72%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTK K+DYEKIVRDTCR+IGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPE+IGAGDQGHMFGYATDET E+MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVT EYYNDNGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKGKIDYEKIVRDTCRNIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK_BRARP (S-adenosylmethionine synthetase OS=Brassica rapa subsp. pekinensis GN=SAMS PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 3.062e-99
Identity = 172/183 (93.99%), Postives = 176/183 (96.17%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GA+LTEVRKN TC WLRPDGKTQVT EYYNDNGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK5_BRAJU (S-adenosylmethionine synthetase 5 OS=Brassica juncea GN=MSAMS5 PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 3.062e-99
Identity = 172/183 (93.99%), Postives = 176/183 (96.17%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GA+LTEVRKN TC WLRPDGKTQVT EYYNDNGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK1_CATRO (S-adenosylmethionine synthetase 1 OS=Catharanthus roseus GN=SAMS1 PE=1 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 3.062e-99
Identity = 173/183 (94.54%), Postives = 177/183 (96.72%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGFVSDDVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVT EYYN+NGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK1_BRAJU (S-adenosylmethionine synthetase 1 OS=Brassica juncea GN=SAMS1 PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 3.062e-99
Identity = 172/183 (93.99%), Postives = 176/183 (96.17%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GA+LTEVRKN TC WLRPDGKTQVT EYYNDNGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNGTCRWLRPDGKTQVTVEYYNDNGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK3_BRAJU (S-adenosylmethionine synthetase 3 OS=Brassica juncea GN=MSAMS3 PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.164e-98
Identity = 171/183 (93.44%), Postives = 176/183 (96.17%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGF+SDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDET E MPLSHVLATK+GA+LTEVRKN TC WLRP+GKTQVT EYYNDNGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPDSKVACETCTKTNMVMVFGEITTKATVDYEKIVRDTCRSIGFISDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETPELMPLSHVLATKIGAKLTEVRKNGTCRWLRPNGKTQVTGEYYNDNGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK2_CATRO (S-adenosylmethionine synthetase 2 OS=Catharanthus roseus GN=SAMS2 PE=1 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 1.520e-98
Identity = 172/183 (93.99%), Postives = 176/183 (96.17%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            METFLFTSESVNEGHPDKLCDQISDAVLDACL QDPESKVACETCTKTNMVMVFGEITTKA+VDYEKIVRDTCR+IGFVSDDVGLDAD+CKVLVNIEQQSPDIAQGVHGH TKRPE+IGAGDQGHMFGYATDET E MPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVT EYYNDNGAM
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKAQVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNDNGAM 183          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK_CARPA (S-adenosylmethionine synthetase OS=Carica papaya GN=SAMS PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.985e-98
Identity = 172/182 (94.51%), Postives = 175/182 (96.15%), Query Frame = 3
Query:   87 METFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGA 632
            METFLFTSESVNEGHPDKLCDQISDAVLDACL QDP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCRSIGFVSDDVGLDAD CKVLVNIEQQSPDIAQGVHGHFTKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN TC WLRPDGKTQVT EYYN+NGA
Sbjct:    1 METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPDSKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGA 182          
BLAST of DC900307 vs. ExPASy Swiss-Prot
Match: METK4_HORVU (S-adenosylmethionine synthetase 4 OS=Hordeum vulgare GN=SAM4 PE=2 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.985e-98
Identity = 170/184 (92.39%), Postives = 178/184 (96.74%), Query Frame = 3
Query:   84 KMETFLFTSESVNEGHPDKLCDQISDAVLDACLEQDPESKVACETCTKTNMVMVFGEITTKAKVDYEKIVRDTCRSIGFVSDDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEDIGAGDQGHMFGYATDETSEFMPLSHVLATKLGARLTEVRKNSTCSWLRPDGKTQVTXEYYNDNGAM 635
            ++ETFLFTSESVNEGHPDKLCDQISDAVLDACL +DP+SKVACETCTKTNMVMVFGEITTKA VDYEKIVRDTCR IGFVS+DVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPE+IGAGDQGHMFGYATDET EFMPLSHVLATKLGARLTEVRKN+TC WLRPDGKTQVT EY+NDNGAM
Sbjct:    3 EVETFLFTSESVNEGHPDKLCDQISDAVLDACLAEDPDSKVACETCTKTNMVMVFGEITTKANVDYEKIVRDTCRGIGFVSNDVGLDADHCKVLVNIEQQSPDIAQGVHGHFTKRPEEIGAGDQGHMFGYATDETPEFMPLSHVLATKLGARLTEVRKNATCPWLRPDGKTQVTVEYHNDNGAM 186          
The following BLAST results are available for this feature:
BLAST of DC900307 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
METK2_ARATH1.795e-9993.99S-adenosylmethionine synthetase 2 OS=Arabidopsis t... [more]
METK1_POPTR1.795e-9993.44S-adenosylmethionine synthetase 1 OS=Populus trich... [more]
METK_BRARP3.062e-9993.99S-adenosylmethionine synthetase OS=Brassica rapa s... [more]
METK5_BRAJU3.062e-9993.99S-adenosylmethionine synthetase 5 OS=Brassica junc... [more]
METK1_CATRO3.062e-9994.54S-adenosylmethionine synthetase 1 OS=Catharanthus ... [more]
METK1_BRAJU3.062e-9993.99S-adenosylmethionine synthetase 1 OS=Brassica junc... [more]
METK3_BRAJU1.164e-9893.44S-adenosylmethionine synthetase 3 OS=Brassica junc... [more]
METK2_CATRO1.520e-9893.99S-adenosylmethionine synthetase 2 OS=Catharanthus ... [more]
METK_CARPA1.985e-9894.51S-adenosylmethionine synthetase OS=Carica papaya G... [more]
METK4_HORVU1.985e-9892.39S-adenosylmethionine synthetase 4 OS=Hordeum vulga... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900307 VSS Citrus sinensis cDNA clone VS28659 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900307 ID=DC900307|Name=DC900307|organism=Citrus sinensis|type=EST|length=635bp
TTGAGTTCCGCTTTGCTATTGAGGTCTGGTCTTAAGTCTGAATCTTAGAT
CTGCGCCGAAACACTTGCCAGCCACAGCTTGATAAGATGGAGACCTTTCT
ATTCACCTCTGAATCTGTGAACGAGGGTCACCCCGACAAGTTGTGCGACC
AGATCTCTGATGCGGTGCTTGACGCCTGCCTTGAGCAGGATCCTGAGAGC
AAGGTTGCCTGTGAGACATGCACCAAGACCAACATGGTCATGGTCTTTGG
AGAGATTACCACCAAGGCCAAGGTAGACTATGAGAAGATTGTTCGCGACA
CTTGCCGTTCCATTGGATTTGTTTCTGATGATGTGGGTCTTGACGCCGAT
CACTGCAAAGTCCTGGTCAATATTGAGCAACAAAGCCCGGATATTGCCCA
GGGTGTTCATGGCCACTTTACAAAGCGCCCTGAGGACATTGGTGCTGGTG
ACCAGGGCCATATGTTTGGTTATGCTACTGATGAGACCTCTGAATTTATG
CCTTTGAGCCATGTCCTTGCCACCAAACTTGGTGCTCGTCTCACGGAGGT
TAGGAAGAATAGTACCTGCTCTTGGCTAAGGCCCGATGGGAAGACCCAGG
TCACTGNTGAGTACTACAACGACAATGGTGCCATG
back to top